KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_07250Help
Entry
BSU6051_07250     CDS       T02503                                 

Gene name
yetO
Definition
bifunctional P-450/NADPH-P450 reductase 1 yetO (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSU6051_07250 (yetO)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BSU6051_07250 (yetO)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU6051_07250 (yetO)
Enzymes [BR:bsh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BSU6051_07250 (yetO)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BSU6051_07250 (yetO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792679..795864
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFRYDIQTMFSLVDSIIAERRANGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTNDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHISVQSRHQEAIHADVQAAEKAAPDEQKEKTEA
KGASVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTKTAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
ASFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDVVMFIRTPESR
FQLPKDPETPIIMVGPGTGVAPFRGFLQARDVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LERFEKDGIVTVHTAFSRKEGMPKTYVQHLMADQADTLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQAVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctcggcaatttgcct
ttaattgataaagacaaaccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccatgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggcaaggctcaacccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaagcggcaattccgctatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgcagggcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaactggtgaaaagctcgacgacgaaaatatccgctttcag
atcatcacgtttttgattgccggccatgaaacaacgagcggcctgctttcctttgcgact
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaaatttccgatcacgacgaatgacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgcagaagaattccggccggaa
cggtttgagcatcaggaccaagtgcctcatcatgcgtacaaaccattcggaaatggacaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgttaggcatgatt
ctaaaatatttcacattgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagtgttcaaagccgtcatcaggaagccattcat
gcagacgtccaggcagctgaaaaagccgcgcctgatgagcaaaaggagaaaacggaagca
aagggtgcatcggtcatcggtcttaacaaccgcccgcttctcgtgctgtacggctcagat
accggcaccgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacggcgta
aggacaaagacagcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaagccgccaagcaatgccggacaattcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcggagaaaggcgcgactcggttttctgcgcgcggggaaggggatgtgagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggatgccatcaaagcattcgga
cttgagcttaatgaaaacgctgataaggaacgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctcgctagatcgtacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtccgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattcttcacagattcggtctgaagggaaccgaccaagtgacattg
tcggcaagcggccgcagtgcggggcatctgccattgggccgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcgtcatttacagtgtgtccgccgcataggcgcgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtat
gaagcgtgtgacatgccgtttgaacgatttttagagcttttacggccgttaaaaccgaga
tactattcgatttcaagctctccaagagtgaatccgcggcaagcatcgatcacagtcggt
gtcgtgcgcggcccggcgtggagcggccgtggcgaatacaggggtgtggcatcaaatgat
ttagctgagcgtcaagccggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccgaaagaccctgaaacgccaattattatggtcgggccaggcacgggagtc
gcgccatttcgcggtttccttcaagcccgcgatgttttaaagcgggagggcaaaacgctc
ggtgaggctcatctctattttggatgcaggaacgatcgggattttatttaccgagatgag
cttgagcggtttgaaaaagacggaatcgtcactgtccacacagccttttcccgaaaagag
ggcatgccgaaaacatatgtccagcatctcatggctgaccaagcagatacattaatatca
atccttgaccgcggtggcaggctttatgtatgcggtgatggcagcaaaatggccccggat
gtggaggcggcacttcaaaaagcgtatcaggctgtccatggaaccggggaacaagaagcg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system