KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_12230Help
Entry
BSU6051_12230     CDS       T02503                                 

Gene name
yjjA
Definition
putative enzyme YjjA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294135..1294947
Genome map
AA seq 270 aa AA seqDB search
MGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNDEVDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacttggaaaacgcgtggcaatcggtggctcacgaaaaacggaagaa
attagtacaatcattgaaaaacagggcggaatacctgtcatccggcctctccaaggtaca
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgcggaagaaaaagct
gactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagagaaa
attggactgaaagatgagtttctgcaggccattcgccaagcgaaagcggcatgccgggga
tacaaaacgctgtctgcgctgaaaaagcttggaatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggagcctcacgacttttcaggaaaaacagtc
atggtgcagcttcatggcgaaaaagcgccggctctcatggcatttcttgaagaaaaaggc
gcgtctgtcctgccgattctgccttatcagcacatcccgccggaggaggaaacggtggag
cggttatgccgagagctgatgaacgatgaggtcgatgccgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccaaggggcgaggttatatcaatgaagtgaagaag
gtattcgaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactgcgg
gaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgattgtt
gagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system