KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_28820Help
Entry
BSU6051_28820     CDS       T02503                                 

Gene name
ysdC
Definition
(GenBank) putative endo-1,4-beta-glucanase YsdC (EC:3.2.1.4)
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(2950203..2951288)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgcaaaaaaaactggtgcagaaaacggc
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgcttgct
cagcgcgtcaccattgtcacaaaaaaaggagaaatcacaggggttatcggatctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtgtacttccgggagatatg
atcgttccgcattttgaatttacggtcatgaacaatgaaaaattcctactcgcaaaggcc
tgggacaaccgcatcggctgtgcgattgctattgatgtgttaagaaacttacaaaacaca
gatcatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcgggctgagggga
gcgaaaacggctgcacacaccattcagcctgatattgcgtttggtgttgatgtagggata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattaccattgca
acccgctacattcatacgcacgcggccatgctgcatcgtgatgattatgaaaacgcggta
aagttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
caataa

DBGET integrated database retrieval system