KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_29080Help
Entry
BSU6051_29080     CDS       T02503                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosidase MutM (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2972311..2973141)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGK
FLLFHLDHYVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMHLF
KPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEA
LFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHF
VYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaattaccagaggttgagacggtccggcgcactctgaccgggcttgtaaaggga
aaaacaatcaaatcggtagagatcagatggccgaatatcatcaaacggcctgccgaaccg
gaggaatttgcgcgaaaactagcaggagaaacgatacagtccatcggaagacggggaaag
tttttactgtttcatttagatcattatgttatggtttctcaccttcgaatggaaggaaaa
tacggtcttcatcaagccgaggagcctgacgataaacacgtgcatgtcatattcacgatg
acggatggaacccagctccggtacagggatgtgcggaaatttggaaccatgcacttattt
aaaccgggagaagaagcgggcgagctcccgctttctcagttagggccggagccggatgca
gaagaatttacaagtgcgtatttaaaagaccggcttgcgaaaacaaaccgcgctgtcaaa
actgccctactggatcaaaaaacggtagttggactcgggaacatttatgtggatgaggct
cttttcagagcgggtgtccatcccgagacaaaagcaaatcaattatcagataaaacaatc
aaaacccttcacgctgaaatcaaaaacactctgcaggaggcgattgatgcgggcggaagc
acagtccgttcatatatcaactcccaaggggaaatcggaatgttccagctgcagcatttt
gtgtacggaaaaaaagacgagccatgcaaaaattgcggaacgatgatttcgaaaattgtc
gttggaggaagaggcacgcatttttgcgcaaagtgccagacaaaaaagtag

DBGET integrated database retrieval system