KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_33620Help
Entry
BSU6051_33620     CDS       T02503                                 

Gene name
yvaK
Definition
carboxylesterase YvaK (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Brite
Enzymes [BR:bsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BSU6051_33620 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3454201..3454947)
Genome map
AA seq 248 aa AA seqDB search
MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPE
ELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPM
HIKSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVD
MIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVY
EFLEKLDW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtg
cttttgctgcatggctttacaggaaatacagcggatgtaaggatgctgggacgatatttg
aatgaacgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaa
gaacttgtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatat
ttaaaatctgaaggttatgagagcattgctgcctgcggactgtcgcttggcggggttttt
tcgctgaaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatg
catattaagagtgaagaggtcatgtatcaaggcgttctttcatacgctcgcaattacaaa
aagtttgaggggaaaagcccggagcaaattgaagaggaaatgaaagaattcgaaaaaacg
ccgatgaataccctcaaggcgctgcaagacttaattgctgatgtgcggaataatgtcgat
atgatttattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaa
agcgccaatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgag
gaatcagggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtat
gaatttttagagaagctcgattggtaa

DBGET integrated database retrieval system