KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_35920Help
Entry
BSU6051_35920     CDS       T02503                                 

Gene name
rbsK
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU6051_35920 (rbsK)
Enzymes [BR:bsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSU6051_35920 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3702399..3703280
Genome map
AA seq 293 aa AA seqDB search
MRNICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGK
VGDDHYGTAILNNLKANGVRTDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAY
ALNALEQIEKVDMVLIQQEIPEETVDEVCKYCHSHDIPIILNPAPARPLKQETIDHATYL
TPNEHEASILFPELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGA
GDTFNAAFAVALAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatatttgtgtgattggtagctgttctatggatttagtggtcacctcggacaaa
cgcccaaaagccggtgaaacggttcttggcacgtcatttcagactgtgccgggcggcaaa
ggagcaaatcaggccgttgccgcagccagacttggggcgcaagtgtttatggtcggcaaa
gttggagacgatcattatggaacagctattttgaataatctcaaagctaacggcgttcgc
actgattatatggaaccggttacacatacggaaagcggaaccgctcatattgtgcttgct
gaaggcgacaacagcattgtcgttgtcaaaggcgcgaacgatgacatcaccccagcgtat
gcgttaaacgcgctcgaacagattgaaaaggtcgatatggtgctgattcagcaggaaatc
ccagaagaaacggttgatgaggtgtgcaaatactgccattctcacgatatcccgatcata
ctaaacccagcaccggcccgcccgctcaagcaggaaacaattgatcacgctacctatctg
acgccgaatgaacacgaggcttcgattttattccctgagcttaccatttccgaagctctg
gcgctttatccggcaaagctctttattacggaaggaaaacaaggcgtccgctattcggct
ggcagcaaagaggtgctcatcccgtccttccctgtagaacccgttgatacaaccggagcc
ggtgatacgtttaacgcagcatttgccgtggccctggctgagggaaaagacattgaagcc
gcattgcggtttgccaatcgtgccgcttccctttctgtctgctccttcggtgcccaaggc
ggaatgccgacaagaaatgaagtagaggagctgctgtcatga

DBGET integrated database retrieval system