KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_37060Help
Entry
BSU6051_37060     CDS       T02503                                 

Gene name
tdk
Definition
thymidine kinase Tdk (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU6051_37060 (tdk)
Enzymes [BR:bsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSU6051_37060 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3802410..3802997)
Genome map
AA seq 195 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSAADIWDHISESTDVVAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGAAESYE
ARCRHHHEVPGKSKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaaacaaagcgggtggcttgagctgatttgcggcagcatgttctcgggg
aaatctgaagagctgatcagaagagtgaagagagcaacttatgccaagcaggaagtcagg
gtatttaagcctgtaattgataaccgatacagcgaagctgctgttgtctcccataatgga
acatcgatgacgagctatgccatttcgtctgctgcggacatttgggatcacatcagtgaa
agtacagatgtggttgcggttgatgaagtgcagttttttgatcaggaaattgttgaggtt
ttatcatctcttgccgataaaggctaccgtgtgatagcagcaggccttgatatggatttt
aggggagagccgttcggtgtcgtcccgaatatcatggcgattgcggaaagtgtgacaaag
ctgcaagccgtctgttctgtttgcggatcaccggcgagcagaacacagcgcctcattgac
ggcaaacctgcttcttacgatgatccggtcattttggttggtgcagctgaatcatatgaa
gcaagatgcagacatcatcacgaagtcccaggtaaatctaaaaaatag

DBGET integrated database retrieval system