KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_37960Help
Entry
BSU6051_37960     CDS       T02503                                 

Gene name
ywdH
Definition
putative aldehyde dehydrogenase YwdH (EC:1.2.1.-)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU6051_37960 (ywdH)
   00040 Pentose and glucuronate interconversions
    BSU6051_37960 (ywdH)
   00053 Ascorbate and aldarate metabolism
    BSU6051_37960 (ywdH)
   00620 Pyruvate metabolism
    BSU6051_37960 (ywdH)
   00640 Propanoate metabolism
    BSU6051_37960 (ywdH)
  Lipid metabolism
   00071 Fatty acid degradation
    BSU6051_37960 (ywdH)
   00561 Glycerolipid metabolism
    BSU6051_37960 (ywdH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU6051_37960 (ywdH)
   00310 Lysine degradation
    BSU6051_37960 (ywdH)
   00330 Arginine and proline metabolism
    BSU6051_37960 (ywdH)
   00340 Histidine metabolism
    BSU6051_37960 (ywdH)
   00380 Tryptophan metabolism
    BSU6051_37960 (ywdH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU6051_37960 (ywdH)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU6051_37960 (ywdH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU6051_37960 (ywdH)
Enzymes [BR:bsh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU6051_37960 (ywdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3896295..3897665
Genome map
AA seq 456 aa AA seqDB search
MNSIPSIISKHKAYFAAGHTRPLESRLNILRKLKQAVRTHEADLIAALYQDLHKSEQEAY
STEIGIVLEEISFVMKRLRKWSKPKRVKTPLTHLGSKSIIIPEPYGTVLVIAPWNYPLQL
ALSPLIGAIAAGNTVVLKPSEYTPAVSAILSKLISSVFPTDYVAMAEGGPDVSTALLQQP
FDYIFFTGSVAVGKIVMEAAAKQLIPVTLELGGKSPCIVHKDADIQLAAKRIVFGKFTNA
GQTCIAPDYLFVHEDIKTKLTEEMKRAIREFYGPQPERNPQYGKIVSERHYQRLLSFLND
GIPLTGGQSDPNHHKIAPTILEQVRDDSPVMQEEIFGPILPLFTYRNIGEVIEKVQSRPK
PLALYLFTTNKEIERAVLGNLSFGGGCVNDTLMHVATPYLPFGGVGESGIGSYHGFDSFN
TFTHKKSVVKQTNRFDFAFRYPSSKNGLRMIRKILK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatcccctctatcatcagcaagcataaagcctattttgcggcgggacatacg
agaccgcttgaatcgagactgaacattttgcgaaagctgaaacaagccgtcagaactcat
gaagccgatctcatagccgctctctaccaggatctccataaatccgagcaagaagcatac
tcaacagaaatcggaatcgtcttggaggaaatcagctttgtcatgaaacggctgagaaaa
tggtccaagccgaaacgagtcaaaacgccgttgactcatctaggctccaaaagcatcatc
atccctgagccgtatggaaccgttttggtgattgcgccttggaactatcccttgcagctg
gcgctttctccgttgattggcgccattgcggcggggaacacggtcgttctcaagccatca
gaatatacgccggctgtttctgctattctttccaaactcatcagcagcgtttttccaact
gattatgtcgctatggcagaaggcgggcccgatgtcagcacagcattattacagcagccc
tttgactacattttctttaccggcagtgtagctgtaggaaaaatcgtcatggaggccgcc
gccaaacaattaattcccgtaaccttggagctcggcggcaaaagtccctgcatcgtccat
aaagatgctgacattcagcttgccgccaaacgcatcgtcttcgggaaatttacaaatgcg
ggacaaacctgcatcgcaccggattatttatttgtccacgaggacatcaaaacgaagctc
acagaagaaatgaagcgtgcgatcagagaattttacggccctcagccggaacggaatcca
cagtacggcaaaatcgtcagtgagcgccactatcagcggctgctcagctttctgaatgat
ggcatcccgctcacaggcggacaatctgatcccaatcatcacaaaattgcgccgaccatt
ctcgaacaagtgagagatgactctccagtgatgcaggaggagattttcgggccgattctt
ccgctctttacataccgcaatatcggggaagtcattgagaaagtccaatcgcgccctaag
ccgctcgccctgtatctcttcaccacaaacaaagaaattgagcgcgctgttttaggaaat
ctgtcgtttggcgggggctgtgtcaatgatacgttaatgcatgttgcgacgccgtatttg
ccattcggcggcgtcggggaaagcggcatcggcagctatcacgggtttgacagttttaac
acattcacgcacaaaaaaagcgtcgtcaaacaaacgaaccgtttcgacttcgcatttcgt
tatccttcctccaaaaacgggctgcgaatgattcgaaaaatactcaaataa

DBGET integrated database retrieval system