KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_40250Help
Entry
BSU6051_40250     CDS       T02503                                 

Gene name
yycR
Definition
putative dehydrogenase YycR (EC:1.-.-.-)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSU6051_40250 (yycR)
  Energy metabolism
   00680 Methane metabolism
    BSU6051_40250 (yycR)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU6051_40250 (yycR)
Enzymes [BR:bsh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BSU6051_40250 (yycR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4135802..4137028)
Genome map
AA seq 408 aa AA seqDB search
MGGMALTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNI
CGSDQHMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKT
QKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLT
MLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQ
ARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMD
VTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLM
KAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaatggcgttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgta
gcggtggaggatatcggttatccggagttaatcttgagggacgggcccggcgtcccgaag
gcgaatgtgaatcgaaaatgtgagcatggggttattctcaaagtcattacaaccaacatt
tgcggaagcgaccagcatatggtcagaggccgcacaacggcgccagaaggcttggtgctc
gggcatgaaattacgggagaagtcattgaaacggggcgtgatgttgaatttatcaaaaaa
ggagatatcgtatccgttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacg
cagaaaacgcatgtgtgcctgaatgtcaatccggaccggccgggatcggcttacggctac
gtcgatatgggcggctgggtcggcggccagtctgaatatgtcatggtgccatacgctgat
tttcagcttttggtattccctgataaagaacaggcgctagaaaagattctcgatttgacc
atgctgtccgacatttttccgaccggcttccatggagcttatacagcgggcgtgcaaaca
ggttcaaccgtttatatcgctggagcgggtcctgtcggcttggcagctgcacactccgct
cagctcctaggcgcctctaccgtgattgtcggcgatctgaacgaagacaggctggcacag
gccagaagcttcggctgtgaaacggtcaacgtgcaaaaacacgaccgcctcggcgagcaa
attgaacaaatactaggtgaaccaaccgttgatgctgcagtggactgtgtcggctttgaa
gcatctgggcacggcaatcaaggagaagcgccagccgccgtgctgaactcaatcatggac
gtcacccaggtcggaggcagccttggcattccaggcttatacgtgaccgaagatcccggt
gcaaaggatgcggacgccaaaacaggctcattaaaaatccgcttcggactcggctgggcc
aaagcccacaccttcgtcaccggacaaacgcccgccatgacatacaaccgcaatttgatg
aaagcgatcctgagcggcagagcgcagatcgcaaaagccgtcaatgccaccgttatttct
ctggacgacgcgccaaaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtc
atcgacccgcatgggacattgaagtaa

DBGET integrated database retrieval system