KEGG   Brucella suis 1330: BS1330_I0195Help
Entry
BS1330_I0195      CDS       T02103                                 

Gene name
cysQ
Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bsi  Brucella suis 1330
Pathway
bsi00920  Sulfur metabolism
bsi01100  Metabolic pathways
bsi01120  Microbial metabolism in diverse environments
bsi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BS1330_I0195 (cysQ)
Enzymes [BR:bsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BS1330_I0195 (cysQ)
Transfer RNA biogenesis [BR:bsi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BS1330_I0195 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P DUF2694
Motif
Other DBs
NCBI-ProteinID: AEM17560
UniProt: A0A0H3G1K6
Position
I:206746..207546
Genome map
AA seq 266 aa AA seqDB search
MRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAIILAALSSACPDVPVV
AEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVEEGAPVLGIVYAPARN
LLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHLTPETERFLAENRIAS
SVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGMTATLDGRPMIYGQRL
RAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccgtccttcgcgacgctgcgcttgaggctggccgcagcatcatgaagcattat
gtcaatggatgcgcggtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcac
gcagcggaagccattattcttgcggccctgtcgtcggcctgccccgatgtgccggtggtg
gcggaggaagaagttgcagcagggcgcttgccggatcatctggggcgcaaattccttctg
gtcgatccgctggacggaacccgggaattcctgctgcgcaacggcgattttacggtcaat
atcggccttgtcgaagagggcgcgccagtactgggtatcgtctatgcaccggcccgcaat
ctgctgtttatcggcagcgatgcgggtgcatgggcaatggaaaccacaccggaccatggc
gcaggccaggaccagcggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgt
agccgctcgcacctgacgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagc
agcgtttcggttggttcctcgcttaaattctgcattcttgccaagggtgaggcggatatt
tatccgcgtttcggcccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgc
gcggcgggcggcatgaccgccactctcgacggcaggccgatgatctatggccagcgcctc
cgtgcaggggcggcgggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcg
cctgttttcaccacggcctga

DBGET integrated database retrieval system