KEGG   Brucella suis 1330: BS1330_I0195Help
Entry
BS1330_I0195      CDS       T02103                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bsi  Brucella suis 1330
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bsi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:206746..207546
Genome map
AA seq 266 aa AA seqDB search
MRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAIILAALSSACPDVPVV
AEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVEEGAPVLGIVYAPARN
LLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHLTPETERFLAENRIAS
SVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGMTATLDGRPMIYGQRL
RAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccgtccttcgcgacgctgcgcttgaggctggccgcagcatcatgaagcattat
gtcaatggatgcgcggtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcac
gcagcggaagccattattcttgcggccctgtcgtcggcctgccccgatgtgccggtggtg
gcggaggaagaagttgcagcagggcgcttgccggatcatctggggcgcaaattccttctg
gtcgatccgctggacggaacccgggaattcctgctgcgcaacggcgattttacggtcaat
atcggccttgtcgaagagggcgcgccagtactgggtatcgtctatgcaccggcccgcaat
ctgctgtttatcggcagcgatgcgggtgcatgggcaatggaaaccacaccggaccatggc
gcaggccaggaccagcggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgt
agccgctcgcacctgacgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagc
agcgtttcggttggttcctcgcttaaattctgcattcttgccaagggtgaggcggatatt
tatccgcgtttcggcccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgc
gcggcgggcggcatgaccgccactctcgacggcaggccgatgatctatggccagcgcctc
cgtgcaggggcggcgggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcg
cctgttttcaccacggcctga

DBGET integrated database retrieval system