KEGG   Brucella suis 1330: BS1330_I1071Help
Entry
BS1330_I1071      CDS       T02103                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bsi  Brucella suis 1330
Pathway
bsi00790  Folate biosynthesis
bsi01100  Metabolic pathways
Module
bsi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BS1330_I1071 (folE)
Enzymes [BR:bsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BS1330_I1071 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEM18413
UniProt: Q8G0L4
Position
I:1045620..1046261
Genome map
AA seq 213 aa AA seqDB search
MDARILQDNDDTSLPVNQASVTRIHKKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRV
AKAYQELFGGYSESPEEVLGTTFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYL
PEGRVVGLSKIARVVDIFARRLQTQESITAQIADSMQRILKPRGVAVMIEAEHMCMAMRS
IRKQGSSTITTTFTGDFKEKADQQVRFMTLIRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctccaagataacgacgacaccagcctgcctgtcaatcaggcatcc
gtaaccagaatacacaaaaagccaggcaaggccgaagcggaagctgccgttcgcaccctg
cttttgtgggccggcgaagaccccgatcgtgaaggcttgctggaaacgcccaagcgcgtc
gcaaaagcctatcaggaacttttcggcggctattcggaaagcccggaagaggttcttgga
accactttcgaggaagtcgcaggttacgacgatatggttctggtgaaggatatttccttc
ttctcccattgcgaacaccacatggtgccgatcatcggcaaggcgcacgtcgcctatctg
ccggaaggccgtgtcgtcggcctgtcgaagattgcgcgtgtcgtcgatatttttgcccgc
cgcctgcaaacgcaggaaagcatcacagcgcagattgccgacagcatgcagcgcattttg
aagccacgcggcgtcgccgtcatgatcgaggcggaacatatgtgcatggccatgcgcagc
atccgcaagcagggttccagcacgatcaccaccacctttaccggcgatttcaaggaaaag
gcggaccagcaggttcgcttcatgaccctgatccgcacttga

DBGET integrated database retrieval system