KEGG   Brucella suis 1330: BS1330_I1137Help
Entry
BS1330_I1137      CDS       T02103                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsi  Brucella suis 1330
Pathway
bsi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01130  Biosynthesis of antibiotics
bsi01230  Biosynthesis of amino acids
Module
bsi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BS1330_I1137 (trpC)
Enzymes [BR:bsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BS1330_I1137 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEM18479
UniProt: P66989
Position
I:1119381..1120187
Genome map
AA seq 268 aa AA seqDB search
MSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKALEAKRAAGQFALIAE
IKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQACSLPAL
RKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEAEMER
ALKLSSRLLGVNNRNLRSFEVNLAVSERLAKMAPSDRLLVGESGIFTHEDCLRLEKSGIG
TFLIGESLMRQHDVAAATRALLTGAEKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatattcttcgcaagatcgaagcctataagcgggaagaaatagccgccgcc
aaggcgcgtcttgcccttgatgaactgaaggcccggacgagggatcagtcagcgccgcgc
ggttttctgaaggcacttgaggccaagcgcgccgccggtcaatttgcactgatcgcggag
ataaagaaagcaagcccgtccaaaggcttgatccgccccgatttcgacccgccagcgctt
gcaaaggcttatgaagaaggcggtgcggcctgtctttccgtgctgaccgacacgccttcc
tttcagggcgcgccggaattcctcacggccgcacgccaggcttgcagcctgcccgcattg
cgcaaggatttcctgttcgacccctatcaggtctatgaagcgcgtagctggggagcggat
tgcattctcatcatcatggccagcgtcgatgacgatcttgcaaaagagctggaagacacg
gctttcgcactgggcatggatgcgctgatcgaagtgcatgacgaagctgaaatggaacgc
gccctgaagctttcctcgcgcctgctcggcgtcaacaatcgcaatctgcgcagcttcgag
gtcaatctcgccgtttccgagcggcttgcgaaaatggctccgtccgaccgtctgctggtt
ggcgaaagcggcatcttcacgcatgaggactgcctgcggcttgaaaagtccggcatcggc
acttttctgataggcgaaagccttatgcgacaacatgacgttgcggcagccacccgcgcg
cttttgacgggtgcggaaaagctatga

DBGET integrated database retrieval system