KEGG   Brucella suis 1330: BS1330_I1838Help
Entry
BS1330_I1838      CDS       T02103                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bsi  Brucella suis 1330
Pathway
bsi00330  Arginine and proline metabolism
bsi00332  Carbapenem biosynthesis
bsi01100  Metabolic pathways
bsi01130  Biosynthesis of antibiotics
bsi01230  Biosynthesis of amino acids
Module
bsi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BS1330_I1838 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BS1330_I1838 (proB)
Enzymes [BR:bsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BS1330_I1838 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF3708
Motif
Other DBs
NCBI-ProteinID: AEM19156
UniProt: P65791
Position
I:complement(1775263..1776399)
Genome map
AA seq 378 aa AA seqDB search
MLKKLKDYRRIVVKIGSALLVDRATGLKREWLESLGQDIAALQHAGVEVLVVSSGAIALG
RTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQILVTLSDTEERRRYLN
ARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATMMGADLLILLSDIDGLYT
APPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKLDAGKIANAAGTAMIITSG
TRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSGKSLLP
AGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARKVAGHKSDEISAILGYDARAA
MIHRNDLVVRAASDAKAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaactaaaagactatcgccgcatcgttgttaaaataggctctgcccttctg
gtggaccgggccacaggcctgaagcgcgaatggctggaaagcctggggcaggatattgcc
gccttgcagcatgcgggcgttgaggtgctggtggtttcgtcgggtgcaattgcactgggg
cgcacggttctgggcctgccgaaaaaggcgctgaagcttgaggaaagccaggcggcggca
gcagccgggcagattgcgctggcgaaggcttatgcggatgtgctgggcggacatggcatc
aagtcgggacagattctggtcacgctttccgatacggaagagcgccgccgctatctcaat
gcgcgcgcaaccatcgagaccctgctgaagctcaaggccgtgccgatcatcaatgaaaac
gatacggtggcaaccaccgaaatccgttatggcgacaatgacaggttggcggcgcgcgtc
gcgaccatgatgggcgcggaccttctgatcctgctttccgacattgacgggctttatacc
gcgccgccgcacaagaatccggatgcgcaatttctgccctttgtcgaaaccatcacgccg
cagatcgaagccatggcgggggcggcagcatccgagctttcgcggggtggcatgaagacc
aagctcgatgcgggcaagattgcaaacgctgccgggaccgcgatgattatcacttcgggc
acgcgtttcggcccgctttcggcaattgaccgaggggagcgtgcaacattgttcgaggct
gcccatgcgccggtcaatgcgtggaagacgtggatttccggcaatctggaaccggctggc
cggttgactgtggatgcgggtgctgtcaaggcgctcaaatccggcaaatcgcttttgcct
gcgggcgtgaaggaagttgacggggatttcgagcgtggcgacacggttgccgtcatgaac
gaggatgggcgggagattgcgcgcggtctgatcgcctatgatgctgctgacgcccgcaag
gttgccgggcataaaagcgatgagatcagtgccattcttggctatgatgcccgcgcggcg
atgatccatcgcaacgatctggtggtgcgggccgccagcgatgcgaaagccgcatag

DBGET integrated database retrieval system