KEGG   Brucella suis 1330: BS1330_I1897Help
Entry
BS1330_I1897      CDS       T02103                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bsi  Brucella suis 1330
Pathway
bsi00020  Citrate cycle (TCA cycle)
bsi00190  Oxidative phosphorylation
bsi00650  Butanoate metabolism
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
bsi01130  Biosynthesis of antibiotics
bsi01200  Carbon metabolism
Module
bsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BS1330_I1897
   00650 Butanoate metabolism
    BS1330_I1897
  Energy metabolism
   00190 Oxidative phosphorylation
    BS1330_I1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: AEM19213
UniProt: A0A0H3G8T2
Position
I:complement(1838632..1839027)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLMGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtactccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcagaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcatgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system