KEGG   Brucella suis 1330: BS1330_I2102Help
Entry
BS1330_I2102      CDS       T02103                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsi  Brucella suis 1330
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BS1330_I2102 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BS1330_I2102 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BS1330_I2102 (trpA)
Enzymes [BR:bsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BS1330_I2102 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2033882..2034721)
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETALKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLYMAAEFRKEDDTTPIVMMGYYNPIYVYGVERFLTDAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGAAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDEKGKVKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgccgaactgaaggccgagggccgtccggcgctc
gtcacctatttcatgggcggcgatcccgatctggaaaccgcgctgaaggtgatgaaagcc
ctgccgaaagccggcgctgacgtgatcgagcttggtatgcccttctccgacccgatggcg
gatggacccgccattcaggcggctggccttcgcgccctgaacgccggacagacgctggcg
aagacgctttatatggcagcagaattccgcaaggaagacgatacgaccccgatcgtcatg
atgggctattacaatccgatctatgtctatggcgtggagcgttttctgaccgatgccaag
gcatccggcgtggatgggctgatcgttgtcgatcttccttccgaaatggatgccgagctt
tgcattccggcaatgaaggcgggcatcaatttcatccgcctcaccacgccgaccacggac
gacaagcgcctgccgaaagtgctgcataattcatcgggctttgtctattatgtctcgatg
aacggcatcaccggcgcggccattgccgatacggcaaaggtcggcgaagcggttcgccat
atcaagaaaagcaccgacctgccgatctgtgtcggtttcggcgtcaagacgccggaacag
gctgcggcaatcgcaacccatgccgatggcgtcgtcgtgggcacggccattgtcaacgca
attgccggtgaactcgatgaaaagggcaaggtgaagggtgatccggttgccgccgcaacc
cggcttgtccacgctcttgcagagagtgtgcgcgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system