KEGG   Brucella suis 1330: BS1330_I2104Help
Entry
BS1330_I2104      CDS       T02103                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsi  Brucella suis 1330
Pathway
bsi00260  Glycine, serine and threonine metabolism
bsi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01130  Biosynthesis of antibiotics
bsi01230  Biosynthesis of amino acids
Module
bsi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BS1330_I2104 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BS1330_I2104 (trpB)
Enzymes [BR:bsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BS1330_I2104 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: AEM19417
UniProt: Q8FXY4
Position
I:complement(2035188..2036408)
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYETAKNDPEFKAELNALS
TFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMSAGRPGVLHGNRTYLLQ
NADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctacaagacgggccctgacgaagagggcatgttc
ggcatattcggtggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcag
caggcttatgaaacggcgaagaatgaccccgaattcaaggcggagttgaacgccctttcc
accttttatgccggccgtccttccaagctctattatgccgaaggcctgagcaaacatctg
ggtggcgctaaaatctacttcaagcgcgaagacctgaaccataccggcagccacaaaatc
aacaattgccttggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgca
gaaacgggcgccggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctg
ccctgtatcgtctatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgc
atgaagctgctcggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagac
gcgatgaacgaagccctgcgtgactgggttacgaatgtcgaggatacctattacctgatc
ggcacggctgccggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatc
ggcaccgaagcgcgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtg
gcagcggtcggcggcggctccaacgccattggcctgttccatccgttcctcgacgacgcc
tcggtgaagatcgtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgc
gcttcgatgagcgcaggccgccccggcgttctgcatggcaaccgcacctatctcctccag
aacgcggatggccaaattctggaaggccattcggtttccgctggtctcgactatccgggc
gtcgggcccgagcattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctc
gacaatgaggcgctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcg
ctcgaatccgcccatgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggac
aaggtgatgatcgtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaag
cttctcggcatggatatctga

DBGET integrated database retrieval system