KEGG   Brucella suis 1330: BS1330_II0337Help
Entry
BS1330_II0337     CDS       T02103                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bsi  Brucella suis 1330
Pathway
bsi00220  Arginine biosynthesis
bsi00250  Alanine, aspartate and glutamate metabolism
bsi00471  D-Glutamine and D-glutamate metabolism
bsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BS1330_II0337
   00220 Arginine biosynthesis
    BS1330_II0337
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BS1330_II0337
Enzymes [BR:bsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BS1330_II0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEM19817
UniProt: Q8FWV5
Position
II:321132..322085
Genome map
AA seq 317 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
FAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSEQTTNFHNRAIAWLLYSAG
TCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMT
MEGLYTASGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAV
ADSLGHNLYTTRGKVSS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
ttcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgcccgctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tccgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggt
acttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgctt
gtaaccgcgaccgaccttgccacgatgggggcaacccttgccgccggcggtgttaatccg
atcagcgggaagcgcatggtttcggcaggcaatgttgccccaattctggccgaaatgacc
atggaaggcctttatacggcttcaggcgattgggcttatacggtcggcctacccggtaaa
agcggtgtcggtggtggcatcatggcggtagtgccgggtgagctggcaattgccgcgttt
tcaccgccgcttgatccagccggaaatagtgtgaaagcaatggctgctgttgccgcagtg
gcagattcacttggccataatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system