KEGG   Brucella suis 1330: BS1330_II0440Help
Entry
BS1330_II0440     CDS       T02103                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bsi  Brucella suis 1330
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(430458..431954)
Genome map
AA seq 498 aa AA seqDB search
MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWVEHDAEEIWKSVQSTIR
IALAQAGISAADVAAIGITNQRETTVVWDRISGKPVHRAIVWQDRRTAQFCDELKRRNLE
PLFTEKTGLLLDPYFSGTKLAWLLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVT
DATNASRTLIYHIGENRWDDELLDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGV
AGDQQTAVIGNACFEPGMMKSTYGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYAL
EGSIFIAGAAVQWLRDEMGFISVVSEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARG
AIFGLTRGTGRAEFARAALESVAYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQ
RLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERE
SAIAGWRDSVSRCLTRPQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatattctggctatcgatcagggaaccacctccacaaggtcgatgctgttc
gacaggaatatgcgggtcgtggggttggggcagcaggaatttacgcagcattttccttcc
tccggctgggtggagcacgatgcggaagaaatctggaaatcggtgcagtccactatccgc
atagcacttgcacaagctggcatcagtgcggcagacgtcgcggcgatcggcatcaccaat
cagcgcgaaacaaccgtcgtatgggaccgcataagcggcaagccggtacaccgcgccatt
gtctggcaggatcgccgcacggcgcagttttgcgacgaactgaagcgccgcaatcttgaa
cctctctttacggaaaagaccgggctgctgctcgacccctatttttccgggacgaaactt
gcatggttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgc
ttcggcaccatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaacc
gacgccacgaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgat
gaactgctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcg
gcggatttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgta
gcgggcgaccagcagacggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaa
tccacctacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcc
tccaaccggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctg
gaaggttcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttc
atttcggtcgtatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatc
tatctggttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggc
gcaatcttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaa
agcgtggcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggcgca
accaatcacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcag
cgactggccgacattctgaacgcacccgtcgatcgcccggtttttctcgaaaccaccgtg
ctgggcgccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttt
tcggaacgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaa
agcgcgattgcgggctggcgggatagcgtttcacgctgcctcacacgaccgcaatag

DBGET integrated database retrieval system