KEGG   Brucella suis 1330: BS1330_II0892Help
Entry
BS1330_II0892     CDS       T02103                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bsi  Brucella suis 1330
Pathway
bsi00220  Arginine biosynthesis
bsi00330  Arginine and proline metabolism
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01130  Biosynthesis of antibiotics
bsi01230  Biosynthesis of amino acids
Module
bsi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BS1330_II0892 (rocF)
   00330 Arginine and proline metabolism
    BS1330_II0892 (rocF)
Enzymes [BR:bsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BS1330_II0892 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEM20348
UniProt: P0A2Y0
Position
II:complement(880731..881651)
Genome map
AA seq 306 aa AA seqDB search
MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTDLGNLAPAAQRPLQHPN
HAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGTVPGIARRAAEKGRKQFVL
WLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKLAAPIDPHNVCMLGIRSVDPA
EREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFLDERGRTAAVMVDLMASLLGRSVMD
RPTISY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtaagattctggggctgcccgttcaggaaggcactggccgcaagggctgtaat
atggggcctgattcctatcgtgcggccgggattgccgatgccataagggaacttgggcac
gagtgcacagatttgggcaatctggcgcctgccgcccagcgcccgctacagcatccgaac
catgcaatcaaggcgcttccatatgccgttgcctggatcgaagcgatcagcgaagcggcc
tatcgcgaaagtgcggaagggttcccgatctttcttggtggcgatcaccttctggcagcg
ggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgcaagcaattcgtgctc
tggctcgatgcgcatacggatttccatacgctggaaaccacgaccagcggcaatcttcat
ggtacgcccgttgcttattataccggtcagaagggctttgagggctatttccccaagctt
gcagcgccgatcgatccgcataatgtctgcatgttgggcattcgcagcgtcgatccggct
gagcgggaagcggtcaagaaaacagaagttatcgtctatgacatgcggctgatcgacgag
catggtgttgccgccctgctgcgccggtttctggagcgcgtgaaggcggaagacgggctg
ttgcatgtgagccttgatgtcgattttctcgatccctccatcgcgccggccgtgggtacg
acggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatggagatgctgcacgac
agcgggctggtgacgagcctcgatctcgttgaactcaatccctttcttgatgagcgcggc
cgcacggccgccgtcatggtggacctgatggcgagccttctgggccgcagcgtcatggac
cgcccgaccatcagctattga

DBGET integrated database retrieval system