KEGG   Brucella suis 1330: BS1330_II1041Help
Entry
BS1330_II1041     CDS       T02103                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bsi  Brucella suis 1330
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BS1330_II1041 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BS1330_II1041 (glk)
   00052 Galactose metabolism
    BS1330_II1041 (glk)
   00500 Starch and sucrose metabolism
    BS1330_II1041 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BS1330_II1041 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BS1330_II1041 (glk)
   00524 Butirosin and neomycin biosynthesis
    BS1330_II1041 (glk)
Enzymes [BR:bsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BS1330_II1041 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1032871..1033902
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVRTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDKAPHKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcagagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctggttcgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgccgccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcagccttcgaggacaaggccccgcacaaggcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system