KEGG   Brucella canis HSK A52141: BCA52141_I0035Help
Entry
BCA52141_I0035    CDS       T01705                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bsk  Brucella canis HSK A52141
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCA52141_I0035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA52141_I0035
  Lipid metabolism
   00071 Fatty acid degradation
    BCA52141_I0035
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCA52141_I0035
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCA52141_I0035
   00626 Naphthalene degradation
    BCA52141_I0035
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCA52141_I0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(21851..22834)
Genome map
AA seq 327 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQDREVYAFTKPGDTEAKDFARSLGAVWAGDSDILPPSPLDAAIIFAPAGELVPAALR
AVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTHTT
IYPLESANEALADLRSGRLSGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcaggacagggaggtttacgctttcacaaagcccggagatacggaagcgaaa
gattttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtca
ccgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgt
gcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatattccatcc
atgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctcacccgg
aacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcacaccaca
atctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgcctcagc
ggggcggctgttcttgtgccatag

DBGET integrated database retrieval system