KEGG   Brucella canis HSK A52141: BCA52141_I0202Help
Entry
BCA52141_I0202    CDS       T01705                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bsk  Brucella canis HSK A52141
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCA52141_I0202
Enzymes [BR:bsk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCA52141_I0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:130133..130753
Genome map
AA seq 206 aa AA seqDB search
MLKIWGRTNSTNVKKALWAAQELNLEYEQIDLGGQFGGLNDPVYLARNPNGLVPLLEDGE
TILWESNVIVRYLAAAYGKDSLWIENPAKRAQAEKWMDWVSTTIAGDFRDVMMHLIRLPA
KQRDPAKLKHGIEGLECSMRIADAGLADQPWFSGADFGIGDIPLGCYAYGWLQFPIERPS
LPRLEDWYHRLQQRTAYRAAVMTPLT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatctggggccgcaccaattccacgaatgtcaaaaaggcgctctgggcagcg
caggaactcaacctggaatatgagcagatcgatcttggcggccagtttggcggattgaac
gatcctgtctatctggcgcgaaacccaaacggccttgtgccgctcctggaagacggtgaa
accattctgtgggaatccaacgtcatcgttcgctatcttgccgccgcttatggaaaagac
agcctctggatcgagaaccccgccaagcgggcgcaggcggaaaaatggatggattgggta
tcaaccaccatagccggcgattttcgcgatgtgatgatgcacctgatccgcctgcccgca
aaacagcgcgatccggcgaaactcaagcatgggatcgaggggcttgaatgctccatgcgc
attgctgacgcgggccttgcagatcagccctggttttccggtgcggatttcgggatcggc
gatattccattggggtgctatgcctatgggtggctccagttcccgattgagcgaccgtcc
ctgccgcgcctcgaagactggtatcatcgcctgcaacagcgtacggcctatcgcgcggcg
gttatgacacccctcacctga

DBGET integrated database retrieval system