KEGG   Brucella canis HSK A52141: BCA52141_I0202Help
Entry
BCA52141_I0202    CDS       T01705                                 

Definition
glutathione S-transferase domain-containing protein
Organism
bsk  Brucella canis HSK A52141
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:130133..130753
Genome map
AA seq 206 aa AA seqDB search
MLKIWGRTNSTNVKKALWAAQELNLEYEQIDLGGQFGGLNDPVYLARNPNGLVPLLEDGE
TILWESNVIVRYLAAAYGKDSLWIENPAKRAQAEKWMDWVSTTIAGDFRDVMMHLIRLPA
KQRDPAKLKHGIEGLECSMRIADAGLADQPWFSGADFGIGDIPLGCYAYGWLQFPIERPS
LPRLEDWYHRLQQRTAYRAAVMTPLT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatctggggccgcaccaattccacgaatgtcaaaaaggcgctctgggcagcg
caggaactcaacctggaatatgagcagatcgatcttggcggccagtttggcggattgaac
gatcctgtctatctggcgcgaaacccaaacggccttgtgccgctcctggaagacggtgaa
accattctgtgggaatccaacgtcatcgttcgctatcttgccgccgcttatggaaaagac
agcctctggatcgagaaccccgccaagcgggcgcaggcggaaaaatggatggattgggta
tcaaccaccatagccggcgattttcgcgatgtgatgatgcacctgatccgcctgcccgca
aaacagcgcgatccggcgaaactcaagcatgggatcgaggggcttgaatgctccatgcgc
attgctgacgcgggccttgcagatcagccctggttttccggtgcggatttcgggatcggc
gatattccattggggtgctatgcctatgggtggctccagttcccgattgagcgaccgtcc
ctgccgcgcctcgaagactggtatcatcgcctgcaacagcgtacggcctatcgcgcggcg
gttatgacacccctcacctga

DBGET integrated database retrieval system