KEGG   Brucella canis HSK A52141: BCA52141_I0467Help
Entry
BCA52141_I0467    CDS       T01705                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bsk  Brucella canis HSK A52141
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCA52141_I0467
Enzymes [BR:bsk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BCA52141_I0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:283332..284192
Genome map
AA seq 286 aa AA seqDB search
MRRTYSKSLKGAEAVVWGIPFDAAVSNRPGARFGPQAIRRASAIFDNDPQYPFERDLFEN
LAVIDYGDCLLDYGNHTKTPSTIEREAAKILKSDAFLLTLGGDHFITWPLLKAHAAKYGP
LALVQFDAHQDTWFNDGRRIDHGSFVARAVRDGIIDPDLSIQIGIRTHAPEDCGIRIIYG
HEVEDMPAAAIADAILKRTNGRKAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRK
LTALDFVGADVVEVAPAYDHADITAIAGATIAMYYLGLLGERKERR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcacttactccaagtcgctcaaaggcgcggaagcagttgtctggggcattcct
ttcgatgccgccgtttccaaccggcccggcgcacgcttcggcccgcaggcgatccggcgc
gcctcggcgatcttcgacaacgatccgcaatatccgttcgagcgtgatcttttcgagaat
ctcgctgtcatcgattatggcgactgcctgctcgactatggcaatcacaccaagacaccc
tccaccatcgagcgtgaagcagcaaaaatcctgaaatccgatgcatttctgctgacgctc
ggcggcgatcatttcatcacatggccgcttctcaaggcccatgccgcaaaatacggcccc
ctcgctctggtgcagttcgatgcgcatcaggatacatggttcaatgatggcaggcggatc
gaccacggctccttcgtggcccgcgcggtgcgcgacggcatcatcgatcccgacctttcg
atccagattggcatccgcacgcatgcgccggaagattgcggcatcaggatcatttatggc
cacgaggtcgaggatatgccagcggcggcgattgccgatgcaatcctgaaacgcaccaat
ggcaggaaagcctatctgaccttcgacattgactgtctcgatccggcttttgcgccggga
accggcacgccggttgcaggcggcccctcctcggcaaagatgctgtctgtcctgcgcaag
ctgacggctcttgacttcgtgggcgccgatgtagtcgaggttgcaccggcctatgaccat
gccgatataacagccatcgcgggagcgacgatcgcaatgtattatctgggccttctgggc
gaacggaaagaacgacgatga

DBGET integrated database retrieval system