KEGG   Brucella canis HSK A52141: BCA52141_I0519Help
Entry
BCA52141_I0519    CDS       T01705                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bsk  Brucella canis HSK A52141
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCA52141_I0519
Enzymes [BR:bsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BCA52141_I0519
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA52141_I0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:308704..309741
Genome map
AA seq 345 aa AA seqDB search
MTDRQSKYLPANISQHVDDVTGSRRLRRMRKADWSRRLVQENHLTVNDLILSFFLTYGSG
VTEPVEAMPGVERYSVDMAVRMAEKAARLGIPAIAPFPREKPEVKTDDGSFVANPDNLIN
RAVRAIKKEVPEIGIITDAALDPFTTHGHDGILRDGEILNDESVAMVVRGALSQAEAGAD
IIAPSDMMDGRVGAVRQALDEHGFSHVPIMSYATKFASAFYGPYRGAIGTQGLLKGDKKT
YYIDPANPEEAVREAEQDIAEGADMLMVKPGLPYLDIIHRLKDEFRLPTFAYQVSGEYAM
IKAAGINGWIDEEKVMMESLLAFKRAGCDGILTYFAMEVAEKLKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgtcagtccaaatatctgccagccaatatcagccagcacgtcgatgacgta
acgggcagccgccgcctgcgccgcatgcgcaaggccgactggtcgcgcaggctggtgcag
gaaaaccacctgacggtgaacgacctcattctttccttcttcctgacctatggctccggc
gtgaccgagccggtggaagcaatgcccggcgtggaacgttattcggtggatatggccgtg
cgcatggctgaaaaagccgccaggcttggcattccagccatcgcccccttcccgcgcgaa
aagccggaagtgaaaaccgacgacggctccttcgtcgcaaacccggataacctcatcaac
cgtgcggtacgcgccatcaagaaagaagtgccggaaatcggcatcatcaccgatgccgcg
ctggaccccttcaccacacatggccatgacggcattttgcgcgacggagaaattctcaac
gacgaatcggtcgccatggtggtgcgcggcgcgctttcccaggccgaggccggtgcagac
atcatcgccccgtccgacatgatggatggccgtgtgggcgctgtccgccaggcactggac
gagcacggcttcagccatgtgccgatcatgtcctatgcgaccaagttcgcctctgccttt
tacggcccctatcgcggcgccatcggcacgcaaggcctgctgaaaggcgacaagaaaacc
tattacatcgatccggccaaccctgaagaagctgttcgcgaagccgaacaggacattgcc
gagggcgccgacatgctgatggtgaaaccgggcctgccctatctcgatatcatccaccgt
ctgaaggacgaattccgcctgccgaccttcgcctatcaggtatccggcgaatatgcgatg
ataaaggctgccgggatcaatggctggatcgacgaggaaaaggtgatgatggaaagcctg
ctcgccttcaagcgcgcaggctgtgacggaattctgacctatttcgcaatggaagtggct
gaaaagctcaaggcctga

DBGET integrated database retrieval system