KEGG   Brucella canis HSK A52141: BCA52141_I0832Help
Entry
BCA52141_I0832    CDS       T01705                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bsk  Brucella canis HSK A52141
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bsk00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bsk00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:511886..513193
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSFAWEGGDP
FGGRPFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGRNFAENTRYLNE
IVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPDVFAFAAATVKTCIDATKRLG
GENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALARTLGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGGTNFDAKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAARMLEDGALSKPLDERYAGWNGEFGKRLLSGLSLDQIAGEVEAKDINPQPK
SGRQEYLENIVNRYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggatttttcggcgatattcagaaggtgcgctatgaggggccggagagcgac
aatccgctggccttccgccattataatgcagatgaaatcgtgctcggcaaacgcatggaa
gaccatttgcgctttgcggtggcctattggcacagtttcgcctgggagggtggcgatccg
ttcggcgggcgccccttcgaccggccgtggttttccaacgagatcgatgcggcaaaactc
aaggccgatgtcgcctttgaattcttctccctgctcggcgcaccttattactgcttccac
gatgccgatgtgcggccagagggccgcaattttgcggaaaacacgcgctatctcaatgaa
attgtcgatattttcgagaagaagcaggccgaaaccggcatgaaactgctctggggcacg
gccaatcttttttccaaccggcgctatatggcgggtgcggccacaaatcccgatcctgat
gtcttcgcttttgccgctgcaacagtgaagacctgtatcgacgccaccaagcggctcggt
ggagagaattacgtgctttggggcggtcgcgaaggctatgaaaccctgctcaataccgat
ctttcgcgtgaactcgaccatatgggccggttccttagcctcgtggtggaatacaagcac
aaaatcggcttcaagggcacgatcctgatcgagcccaagccgcaggagccgaccaaacat
cagtatgattacgatgtcgcgacggtttacggcttcctcaagcgttacggtctggaaaac
gaggtgaaggtcaatatcgagcagggccatgccattctggccggtcactcgttcgagcat
gagctggcgcttgcccgcacacttggcattttcggctccatcgacatgaaccgcaacgat
taccaatccggctgggacaccgatcagttcccgaacaatgtgccggagatggcgctggcc
tattatcaggttctgctggcaggcggcttcacgaccggcggcacgaatttcgacgccaag
ctgcgccgccagtcgcttgatccgcaggatctgctaatcggccatattggcggcatggat
tgctgtgcacgcggactaaaagcagccgcgcggatgcttgaagacggcgctttatccaag
ccgcttgatgagcgttatgcgggctggaacggcgagttcggcaagaggcttctgagcggc
ctttcgctggaccagatcgcgggtgaagtcgaagcgaaagacatcaatccgcagccgaaa
tccggccgtcaggaatatctggaaaacatcgtcaatcgctacgtttga

DBGET integrated database retrieval system