KEGG   Brucella canis HSK A52141: BCA52141_I1324Help
Entry
BCA52141_I1324    CDS       T01705                                 

Definition
glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
bsk  Brucella canis HSK A52141
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bsk00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bsk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:814662..815927
Genome map
AA seq 421 aa AA seqDB search
MTTENLLESALVRLDEAASHINIDADVIEKLKFARETMKVRLMIRMDDGSRKSFIAWRCR
YDDTRGPTKGGIRYHPDSTVEEVETLAFWMTFKCAVMNLPYGGGKGAIQVDPRQLSKAEL
ERLSRAYIQAFSGIIGPDRDIPAPDVYTNSMIMGWMADEYSQIVGQSSPAVITGKPIALG
GSLGRNDATARGGFYLVRHLSHDLGLASVLRVAIQGFGNAGQFMAKLMAGDGHKIVAVSD
SAGAVYCADGLDVDLLLAAKADGKSVISTAGHKGHEAISADELVAADCDVLVPSTMENMI
HASNAASIRAKLIVELANGPVTGDADKILAEKGVMVLPDILANAGGVTVSYFEWVQNRQG
YYWTLEEIHERLKTIMEREGRAIWNHARERGVTLRTAAYVHALERLAQAIEAHGTQNDFA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggaaaatctgctcgaaagtgcactcgtccggctggacgaagcggcaagccac
ataaacatcgatgcggatgtcatcgaaaagctgaagtttgcgcgtgagaccatgaaagtg
cggttgatgatccgcatggacgacggttcgcgcaagtcctttattgcgtggcgctgccgc
tatgacgacactcgcggaccgaccaagggcggcatccgctaccatcccgattcaacggtg
gaagaagtcgagacgctcgccttctggatgaccttcaaatgcgccgtgatgaacctgcct
tatggcggcggcaagggcgcgatccaggtcgatccgcgccagctctccaaggctgaactg
gagcgcctttcgcgcgcctatatccaggctttctccggcatcatcggcccggaccgcgac
attccggccccggacgtctatacgaattccatgatcatgggctggatggctgacgaatac
tcccagatcgtcggccagtcctctcccgccgtcattaccggcaagcccatcgcacttggt
ggctcgctcggacgcaatgacgcgaccgcacgcggcggcttctacctcgttcgccacctc
tcgcacgatctgggcctcgcttcggttctgcgcgtcgccatccagggttttggcaatgcc
ggacagttcatggccaagctgatggcgggcgacggccacaagatcgtcgccgtgtcggat
tccgcaggggcggtctattgcgcggatggccttgacgtcgacctgcttctggccgccaag
gctgatggcaagtccgtcatttcaaccgccggtcacaagggccacgaggcgatcagcgcc
gacgaactcgtcgccgccgattgtgacgtgctggtgccaagcaccatggaaaacatgatc
catgccagtaatgcagcttccattcgcgccaagcttatcgtggaactggccaacggcccg
gtcacgggggacgctgacaagatcctcgccgaaaagggtgtgatggtcctgccggacatt
cttgccaatgctggcggcgtgacggtttcctattttgaatgggtgcagaaccgtcagggt
tattactggacgcttgaagaaatccatgaacgcctgaagacgatcatggaacgcgaaggc
cgcgccatctggaaccatgcccgcgaacgcggtgtgaccctgcgcacggctgcctatgtg
catgcgctggagcgccttgcacaagcgatcgaggcccacggcacgcaaaacgacttcgcg
gcctga

DBGET integrated database retrieval system