KEGG   Brucella canis HSK A52141: BCA52141_I1565Help
Entry
BCA52141_I1565    CDS       T01705                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bsk  Brucella canis HSK A52141
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bsk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:964337..965062
Genome map
AA seq 241 aa AA seqDB search
MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDALPTEQLSQVKIVGFGDS
LMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTGGLSRIDWSIPDGTNLVIL
ELGANDALRGIQPDITEKNLDEMLAKLKARSISVILAGMVAPPNMGKDYAGKFNPIYPRL
ARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETIVANFMPSVEKALKNLQNTGTSG
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcaaactccaaattcccgcagccgcgatgctcaaggcgcttctggtttcg
cttttggcactttttgtcgcggccgcaagtgcaagcgcgcaagaagaaccgacaggcctt
gaagatgcgctgcccaccgaacagctctcgcaggtgaagatcgtgggcttcggcgacagc
ctcatggctggctatcttctgccgtcgaatgccgcctttccacagcagcttgaaaaggcg
ctcaacgacaagggctacgaggtgacggtcgaaaatgcgggcgtatcgggcgacaccacg
accggcgggctttcgcgtatcgactggtccattcccgatggtaccaatctggtgatcctg
gaacttggcgcaaacgatgcgctgcgcggcatccagccggatatcacggaaaagaatctc
gatgaaatgctggcaaagctgaaggcgcgcagcatttccgtcatccttgcaggcatggtt
gcccctcccaatatgggaaaagactatgcaggcaaattcaacccgatctatcccaggctg
gcgcgcaaatatgatgtgccgctctacccgttcttcctcgacggtgtagcaaccaggaaa
ggacttttgctcgaggacggaatgcatcccaatgaaaagggtgtcgaaacgatcgtggcc
aatttcatgccgtcggtcgaaaaggcgctcaagaatttgcaaaacacggggacatcgggc
ggatga

DBGET integrated database retrieval system