KEGG   Brucella canis HSK A52141: BCA52141_I1702Help
Entry
BCA52141_I1702    CDS       T01705                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00071  Fatty acid degradation
bsk00280  Valine, leucine and isoleucine degradation
bsk00281  Geraniol degradation
bsk00310  Lysine degradation
bsk00360  Phenylalanine metabolism
bsk00362  Benzoate degradation
bsk00380  Tryptophan metabolism
bsk00410  beta-Alanine metabolism
bsk00627  Aminobenzoate degradation
bsk00640  Propanoate metabolism
bsk00650  Butanoate metabolism
bsk00903  Limonene and pinene degradation
bsk00930  Caprolactam degradation
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01212  Fatty acid metabolism
Module
bsk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCA52141_I1702
   00650 Butanoate metabolism
    BCA52141_I1702
  Lipid metabolism
   00071 Fatty acid degradation
    BCA52141_I1702
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCA52141_I1702
   00310 Lysine degradation
    BCA52141_I1702
   00360 Phenylalanine metabolism
    BCA52141_I1702
   00380 Tryptophan metabolism
    BCA52141_I1702
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCA52141_I1702
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCA52141_I1702
   00281 Geraniol degradation
    BCA52141_I1702
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCA52141_I1702
   00627 Aminobenzoate degradation
    BCA52141_I1702
   00930 Caprolactam degradation
    BCA52141_I1702
Enzymes [BR:bsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCA52141_I1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEW14092
Position
1:complement(1055224..1055997)
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSENA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQK
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaacgct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgtcattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system