KEGG   Brucella canis HSK A52141: BCA52141_I2305Help
Entry
BCA52141_I2305    CDS       T01705                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsk  Brucella canis HSK A52141
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCA52141_I2305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA52141_I2305
   00620 Pyruvate metabolism
    BCA52141_I2305
   00640 Propanoate metabolism
    BCA52141_I2305
  Energy metabolism
   00680 Methane metabolism
    BCA52141_I2305
Enzymes [BR:bsk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCA52141_I2305
Lipid biosynthesis proteins [BR:bsk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCA52141_I2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1420217..1422229)
Genome map
AA seq 670 aa AA seqDB search
MHYAMPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKH
GRRIDWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPY
IDKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVF
AGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVR
RTGGKVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGY
LVYASMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGR
FWEVVDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNV
VGDQKCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVAD
GNLCISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLN
ISGHRLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKEL
VQHVRKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVD
DLIENRQNKK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgcattatgcaatgccggatggttctatttggctgcaaatgctgaaggaggaaatcatg
tcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaacgag
acttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaagcac
ggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaacggc
gatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatcgac
cgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccctat
atcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaatgtg
ctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatcccg
gaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtcttt
gccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttcgtc
atcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacaccgat
accgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtgcgc
cgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaagtc
gcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttcatt
ctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggctac
ctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatctac
tggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccgctg
gccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggccgt
ttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcgctg
cgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctgcgc
ctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaatgtc
gtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggcatc
ctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccgttc
ttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagccgac
ggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgaccac
aagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgatggc
tgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctgaat
atttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcactcg
gtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctattgc
tatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaactg
gtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagtttgcg
cccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatcgcc
gaagacgagttcggcgcattgggcgacacctcaacgctcgccgatccgggcgtggtggac
gacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system