KEGG   Brucella canis HSK A52141: BCA52141_I2471Help
Entry
BCA52141_I2471    CDS       T01705                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsk  Brucella canis HSK A52141
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCA52141_I2471
Enzymes [BR:bsk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BCA52141_I2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1515065..1515682
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDEIAEDHAVIDVHGVGYVAFCSARTLGNLGGAGEAAILFIETYVREDMIRL
YGFATQLEREWFRLLQNVQGVGAKVALAVLGTLSPSELANAIALRDIAMVSRAPGVGKKV
AERIVTELKNKAPAFAGEASGTIGLKQELGAGAAPAPVADAVSALSNLGYSRDQAANAVA
AALKETGEGADSAKLIRLGLKELSQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagttgaagggcgtgattgacgaaattgccgaggaccatgctgtcatcgac
gtgcatggcgtgggctatgtcgcgttttgttcggcgcgcacgctgggcaatctcggtggc
gcgggcgaggcggccatcctgttcatcgaaacctatgtccgtgaagatatgatccgcctt
tatggatttgccacgcagcttgagcgcgaatggttccgcctgttgcagaatgtgcaaggg
gtgggggccaaggtggctttggcggtgcttggcaccctgtcgccgtccgaacttgccaat
gcgattgcgctgcgcgacattgccatggtttcgcgcgcgccgggcgtcggcaagaaagtg
gcagagcgtatcgttaccgaattgaagaacaaggctcccgcctttgccggtgaggcgagc
ggcacgatcgggctcaagcaggagcttggcgcaggtgcggcgcctgcacccgttgccgat
gcggtttcggcgctttccaacctcggttattcgcgcgatcaggccgccaatgccgtggca
gccgccttgaaggaaacgggcgagggcgccgattcggccaagctgatacggctcggtttg
aaggaactctcgcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system