KEGG   Brucella canis HSK A52141: BCA52141_I2883Help
Entry
BCA52141_I2883    CDS       T01705                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bsk  Brucella canis HSK A52141
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCA52141_I2883
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCA52141_I2883
Enzymes [BR:bsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BCA52141_I2883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1765463..1766935
Genome map
AA seq 490 aa AA seqDB search
MTMKLKEIALFNELASGEAGEVEITGITSDSRAVQRGFLFAALKGVKADGAVFAADAVKR
GAVAIIAGKDTAIADAGVPVLHVDDPRHVLAIAAAQFYGKQPEVMVAVTGTSGKTSVASF
TRQIWAYAGFPAANIGTTGVFSPTRSDYNSLTTPDPVELHRVLAELTSEGVTHAAMEASS
HGLDQRRLDGVRLAAGAFTNLGRDHMDYHATIDEYLGAKMRLFNALLPKGAPAIIFADDQ
FSAQAIEAATLAGCDVKTVGRKGNFIALKRVEHERFRQHVEVRIGEEIFEIELPLAGDFQ
VANALVAAGLAMVTGVPAAAAMRALALLKGAPGRLDLVGATEDGAPAYVDYAHKPEALEN
VLTSVRPFTTGRVIVVFGCGGDRDKGKRPIMGEIASRLADVVIVTDDNPRSEVPAQIRSE
IMAAATGATEIGDRREAIFTAVSMMQPGDTLVVAGKGHEEGQIVGNITLPFSDHAEVAAA
LAARLEEHPK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaaactgaaggaaatcgctctctttaatgagctggcctccggcgaggccggt
gaagtggaaattaccggcatcacttcggattcccgcgctgttcaacgcggttttcttttt
gcggcgctgaaaggcgtgaaagcggacggtgcggttttcgccgccgatgccgtaaagcgc
ggtgctgtcgccatcatcgcgggcaaggacacggccatcgctgatgcgggtgtgccggtg
cttcatgtggatgatccgcgccatgttctcgccattgccgccgctcaattttatggcaag
cagccggaagtcatggttgccgtgaccggcaccagcggcaagacttccgttgcctccttc
acgcgccagatctgggcctatgcggggtttcccgcagccaatatcggcacgaccggcgtg
ttttcgccgacgcgcagcgactataattccttgacgacgcccgacccggtggaactgcac
cgcgttctggccgaacttaccagcgagggcgtgacccatgcggcgatggaagcctcgtcg
cacggtctggaccagcgtcgtctcgacggggtgaggcttgctgcgggcgccttcaccaat
cttggccgcgatcacatggattatcacgcgaccattgatgaatatctgggcgcgaaaatg
cgcctgttcaacgcgcttctgccgaagggtgcgccagccatcatctttgccgacgatcaa
ttttcggcgcaggccatcgaagcggcgacgcttgctggatgcgacgtgaagacggtcggt
cgaaaaggcaatttcattgccctcaagcgcgtggaacacgagcgtttccgccagcatgtg
gaagtgcggatcggcgaggaaatctttgaaatcgaattgccgctggcgggagattttcag
gtcgccaatgcgctggttgcagcggggcttgccatggtgacgggcgttccggctgcggct
gccatgcgtgcattggcacttctcaaaggcgcaccgggacggcttgatcttgtcggtgca
acggaagatggtgcgccagcctatgttgattatgcccataagccggaagcgttggaaaat
gtgctgacctccgtgcgtccgtttacgacgggccgtgtgattgtggtctttggctgcggc
ggcgaccgcgacaagggcaagcgcccgatcatgggtgagattgcctcgcgtcttgccgat
gtcgtgattgtcaccgacgacaatccccgttcggaagtgccagcacagatacgttccgaa
atcatggcagcggcaacgggagcgacggaaattggcgaccgacgcgaggcgatcttcacc
gccgtttccatgatgcagcccggcgatacgctggtggttgcgggcaagggacatgaggaa
gggcagatcgtcggcaatattacgctgccgttttcagatcatgcagaagtggcggcggca
cttgccgcccgtcttgaggagcatccaaaatga

DBGET integrated database retrieval system