KEGG   Brucella canis HSK A52141: BCA52141_I2945Help
Entry
BCA52141_I2945    CDS       T01705                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bsk  Brucella canis HSK A52141
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bsk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1808462..1808980
Genome map
AA seq 172 aa AA seqDB search
MKKPLVSIVVAVSENNVIGQENDMPWRLSTDLKRFKALTLGKPVIMGRRTWQSLGRPLPG
RANIVITRDADFRAEGAEVVGSLEDALALARKFAAEGGVDEICVIGGGQIYVQAMPLADR
LHLTRVLSVIEGDTYFPEINPQDWQLLSSEDVPAGDKDSYPTRYMLYERRVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccactcgtttccatcgtcgtggcggtctccgaaaacaatgtgatcgggcag
gaaaacgatatgccatggcgtctttccaccgacctgaagcggttcaaggcgctgactttg
ggcaagccggtcatcatggggcggcgcacctggcagtcgcttggccgtcccctgccgggg
cgggccaatatcgtcattacccgtgatgccgatttccgggcagaaggtgccgaggtggtc
ggttcgctggaggatgcgctagcgcttgcgcgcaagtttgcggcggaaggcggggtggac
gaaatctgtgtgatcggcgggggacaaatctatgtacaggccatgccgcttgccgatcgc
ttacacctgacgcgcgttctctctgtcatcgaaggcgatacatattttcctgaaatcaat
ccgcaggactggcaattgctttcgagcgaggatgtgcccgccggtgacaaagacagctat
ccaacacgctatatgctgtacgaaaggcgcgtttcgtaa

DBGET integrated database retrieval system