KEGG   Brucella canis HSK A52141: BCA52141_I2945Help
Entry
BCA52141_I2945    CDS       T01705                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bsk  Brucella canis HSK A52141
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCA52141_I2945
   00670 One carbon pool by folate
    BCA52141_I2945
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BCA52141_I2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1808462..1808980
Genome map
AA seq 172 aa AA seqDB search
MKKPLVSIVVAVSENNVIGQENDMPWRLSTDLKRFKALTLGKPVIMGRRTWQSLGRPLPG
RANIVITRDADFRAEGAEVVGSLEDALALARKFAAEGGVDEICVIGGGQIYVQAMPLADR
LHLTRVLSVIEGDTYFPEINPQDWQLLSSEDVPAGDKDSYPTRYMLYERRVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccactcgtttccatcgtcgtggcggtctccgaaaacaatgtgatcgggcag
gaaaacgatatgccatggcgtctttccaccgacctgaagcggttcaaggcgctgactttg
ggcaagccggtcatcatggggcggcgcacctggcagtcgcttggccgtcccctgccgggg
cgggccaatatcgtcattacccgtgatgccgatttccgggcagaaggtgccgaggtggtc
ggttcgctggaggatgcgctagcgcttgcgcgcaagtttgcggcggaaggcggggtggac
gaaatctgtgtgatcggcgggggacaaatctatgtacaggccatgccgcttgccgatcgc
ttacacctgacgcgcgttctctctgtcatcgaaggcgatacatattttcctgaaatcaat
ccgcaggactggcaattgctttcgagcgaggatgtgcccgccggtgacaaagacagctat
ccaacacgctatatgctgtacgaaaggcgcgtttcgtaa

DBGET integrated database retrieval system