KEGG   Brucella canis HSK A52141: BCA52141_II0074Help
Entry
BCA52141_II0074   CDS       T01705                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bsk  Brucella canis HSK A52141
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCA52141_II0074
   01212 Fatty acid metabolism
    BCA52141_II0074
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCA52141_II0074
   00650 Butanoate metabolism
    BCA52141_II0074
  Lipid metabolism
   00071 Fatty acid degradation
    BCA52141_II0074
   01040 Biosynthesis of unsaturated fatty acids
    BCA52141_II0074
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCA52141_II0074
   00310 Lysine degradation
    BCA52141_II0074
   00380 Tryptophan metabolism
    BCA52141_II0074
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCA52141_II0074
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCA52141_II0074
   00281 Geraniol degradation
    BCA52141_II0074
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BCA52141_II0074
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BCA52141_II0074
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCA52141_II0074
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BCA52141_II0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:55475..57691
Genome map
AA seq 738 aa AA seqDB search
MAYVNFKVETDADGIALVTWDMPEKSMNVFTVDAMQELNAIIDAVIADDKIKGVVITSGK
ETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMSGLFRKLETCGKPWVSAIN
GTCMGGAFEMSLACHARVASDAPGVKMALPEVKVGLFPGAGGTQRVPRLANQQDALQMMT
TGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLKPVQPWDEKGFKLPGGAIYSAAG
ANLWPAATAILRRETSGNYPAALAILKSVYEGLLVPFDTGLKIEQRYFTEILQTTEAGMM
IRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGAGFMGAGIAYVTAKAGIPVVLIDRDQE
SADKGKAHTADLITKEMQKGHATEADKEKLLSLITATPDYAQLEGADLVIEAVFEDREVK
RVATEKAEEVLKSSAVFASNTSTLPITGLAKVSKRPKNFIGIHFFSPVDKMMLVEVILGK
KTSDKALAVALDYVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYNMLVEGVPAAMIENAA
RMAGMPVGPLALNDETAIDLSQKILKATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNG
KGFYDYPAKPAKKHLWPGLKDLYPQQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGTLSYIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENG
ETFYQRFNPYKGETKKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtaaatttcaaggttgaaaccgacgccgacggcattgctctcgttacatgg
gacatgcccgaaaagtcgatgaatgtcttcaccgtcgatgcgatgcaggaactgaatgca
atcatcgatgcggtgatagctgacgacaagatcaagggtgttgtcatcacctccggcaag
gaaaccttctccggcggtgccgacctgaccatgctggaaggcatgttcaaggaattccag
aagcagaaggtcaaggaccccgaaggcgcggttcagaccctgttcgacaatgtcggcaag
atgagcggcctgttccgtaagcttgaaacctgcggcaaaccgtgggtttcggccatcaac
ggcacctgcatgggcggcgcatttgaaatgtcgctcgcctgccatgcgcgtgtggcgtcc
gatgcgccgggcgtgaagatggccctgccggaagtgaaggtcggccttttccccggtgct
ggcggcacgcagcgcgttccgcgccttgccaaccagcaggacgcgcttcagatgatgacg
acgggttcaagcctcaccgcgcagcgcgccaaggctatgggccttgtcaccgagattgct
ccggccaagaagctggtcgaaacagccaagaagctcatcaagggtggcctcaagccggtt
cagccctgggatgaaaagggcttcaagctgccgggcggcgcgatttattcggctgccggt
gcaaacctctggcctgccgcgaccgccatcctgcgtcgcgaaacatcgggtaattatccg
gcggcactcgccattttgaagtcggtttatgagggccttctggtgcctttcgacaccggc
ctcaagattgaacagcgctatttcaccgaaatcctccagacgaccgaagcgggcatgatg
atccgctcgctcttcgtgtcgttgcaggagttgaacaagggtgcgcgccgtccggttgac
gaaaagccgaccaggctcaagaagatcggcgtcatcggcgcgggcttcatgggtgcaggc
attgcctatgtgacggcgaaggccggtattccggtcgtgctgatcgaccgcgatcaggaa
tctgccgacaagggcaaggcccacacggcagacctaatcaccaaggaaatgcagaagggc
catgccaccgaggccgacaaggaaaaacttctgtcgctcatcacagcaacgccggattat
gcccagcttgaaggtgctgatctggtgattgaagccgtgttcgaggaccgcgaagtcaag
cgcgttgcgaccgagaaggccgaggaagtgctgaaatcttccgcagtcttcgcctccaac
acctcgaccctgccgatcaccggtcttgccaaagtgtcgaagcgtccgaagaattttatc
ggcatccacttcttctcgcctgtcgacaagatgatgctggtggaagtgatcctcggcaag
aagacctctgacaaggcattggccgtagcactcgattatgtccgtgcgatcaagaagacg
ccgatcgtcgtcaacgatacgcgcggcttctacgtcaaccgttgcgtgctgcgctatatg
tcggaagcctacaacatgcttgttgaaggcgtcccggcggcgatgatcgaaaatgccgcc
cgcatggccggtatgccggtcggcccgcttgcgctcaacgacgaaacggccatcgacctg
tcgcagaagatcctgaaagccacgcttgccgatcttggtccgaaggccgttgacccgcgc
catgtggaattggtggacaagcttgtcaacgagttcgaccgcaagggccgcaagaatggc
aagggcttctacgattatccggcaaagcctgccaagaagcatttgtggccgggtctgaaa
gacctctatccgcagcagaacccggacaagatcgatgtgaaggagcttaaagagcgcttc
ctcgtcaccatcgctctggaagctgcccgcgtgatggaagaaggcattgtgaccgatccg
cgtgaagccgatgtcggctccatcctcgccttcggtttcgcgccttatacgggcggcacg
ctctcctatatcgatggtatgggcgcgaagaaattcgtccagctcgccaaggatttgcag
aagaaatatggcgcacagttcaaggcgccgaagcttctgctcgatatggccgagaacggc
gaaaccttctaccagcgtttcaatccctataagggcgaaacgaaaaaagcagcctga

DBGET integrated database retrieval system