KEGG   Brucella canis HSK A52141: BCA52141_II0560Help
Entry
BCA52141_II0560   CDS       T01705                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bsk  Brucella canis HSK A52141
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCA52141_II0560
Enzymes [BR:bsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BCA52141_II0560
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA52141_II0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:363926..365344
Genome map
AA seq 472 aa AA seqDB search
MGLGQQEFTQHFPSSGWVEHDAEEIWKSVQSTIRIALAQAGISAADVAAIGITNQRETTV
VWDRISGKPVHRAIVWQDRRTAQFCDELKRRNLEPLFTEKTGLLLDPYFSGTKLAWLLNH
VPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDELLDIL
GIPAAMLPEVKDCAADFGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKSTYGTG
CFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFISVASE
VSALAEKADPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESVAYQT
FDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLGAAWL
AASRAGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggggttggggcagcaggaatttacgcagcattttccttcctccggctgggtggagcac
gatgcggaagaaatctggaaatcggtgcagtccactatccgcatagcacttgcacaagct
ggcatcagtgcggcagacgtcgcggcgatcggcatcaccaatcagcgcgaaacaaccgtc
gtatgggaccgcataagcggcaagccggtacaccgcgccattgtctggcaggatcgccgc
acggcgcagttttgcgacgaactgaagcgccgcaatcttgaacctctctttacggaaaag
accgggctgctgctcgacccctatttttccgggacgaaacttgcatggttgctgaaccat
gttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgcttcggcaccatcgatagc
tggctgatctacaagctcaccggcggcaaggcgcatgtaaccgacgccacgaatgcctcg
cgtacattgatctatcatatcggcgaaaaccgttgggatgatgaactgctggacatattg
ggcattccagccgccatgctgccggaagtgaaggactgcgcggcggatttcggcatgacg
gaccctgcccttttcggcgtttccattcctattctcggcgtagcgggcgaccagcaggcg
gcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacctacggcaccgga
tgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaaccggctgctcacc
accatcgcctaccggctcgacggtgttacgacctatgcgctggaaggttcgatattcatc
gcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcggtcgcatcggaa
gtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctggttccagccttc
accgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatcttcgggttgacg
cgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtggcctatcagacc
ttcgaccttctggaagccatgcaaggggactggaaaggcgcaaccaatcacacggtgctg
cgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactggccgacattctg
aacgcacccgtcgatcgcccggtttttctcgaaaccaccgtgctgggcgccgcatggctg
gccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaacgctggcagcgt
gattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcgattgcgggctgg
cgggatagcgtttcacgctgcctcacacgaccgcaatag

DBGET integrated database retrieval system