KEGG   Brucella canis HSK A52141: BCA52141_II0802Help
Entry
BCA52141_II0802   CDS       T01705                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bsk  Brucella canis HSK A52141
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BCA52141_II0802
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BCA52141_II0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(535478..537397)
Genome map
AA seq 639 aa AA seqDB search
MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALAAGAAKGGMSPEVKPGE
LDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWGLTNESRKVLTEGLLPQDR
EFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPN
QHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDVKQYHAIFTAVDGETMKVAWQVM
VDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKE
MNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFD
DKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPI
RQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKM
VIVHDGPSFAEPHDATIVHRSKINPVSFWSREDPFFADAVARAKADGLDLMEANEVVRDG
NKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQAT
ASVTFKASKPGVWWYYCSWFCHAMHMEMQGRMLVEPKKA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaaccaggaaatcgcagctcagtcgaagacaattgctcggaacttcggca
tttgtcgcggcagccggtgcaagcgggctcggcggggctctgcttgccggttccagcgaa
actgcgcttgcggctggcgccgcaaagggcggcatgagccccgaagtcaagccgggggaa
ctggacgaatattacgtctttttctccagcggccagtgtggtgaagtgcgtattgtcggc
ctgccgtcgatgcgtgagctgatgcgcatcccggtcttcaaccgtgacagcgccaccggt
tggggcctgacgaatgaaagccgcaaagtgttgacggaaggcctgcttccgcaggaccgt
gaattcctcaaggatcgcggcgacatcttcctcaatggcgacctgcaccacccgcatccc
tctttcaccgatggaacctatgacggtcgttatctttatgccaacgacaaggccaatacg
cgcgtctgccgtatccgcctcgacgtgatgaagtgcgacaagatcattcagttgccgaac
cagcatacggttcacggcctgcgtgtgcagaaatatccgaagaccggctatgtcttctgt
aatggcgaagaccgtgtaccgatcccgaatgatggcagccacctgaatgacgtcaagcag
taccatgccatcttcaccgccgttgacggtgaaacgatgaaggtcgcctggcaggtgatg
gtcgatggcaatctcgacaatgtggattgcgactatcagggcaaatatgccttctctact
tgctataattcggaagaggggacgacccttgccgaaatgatgtcgagcgagcaggactgg
attgtcgtcttcaacctgaagcgtatcgaagaagccgtcgccaatggcgatttcaaggaa
atgaacggtgtgccggtcatcgacggtcgccacggctccaaatatacgcgctatattccg
gtgccgaacagcccgcacggtatcaacaccgcgccggacggcatccatgtggtcgccaat
ggcaagctgtcgccgaccgtgacggtgttcgatgtgcgcaagttcgacgacctgttcgac
gacaagatcaagccgcgcgacgctgttgtggccgagccggaactggggcttggaccattg
cacacggcctatgatgacaagggcaacgcctatacgacgctcttcatcgacagccagatc
tgcaaatggaacattgaagacgccaagcgcgcattcaagggcgaaaaggtcgatccgatc
cgtcagaagctcgacgttcattatcagccgggccacaatcacagctccatgggccaaacc
aaggaagttgatggcaagtggctgatttcgctgaacaagttctccaaggaccgttacctc
aatgtcggtccgctcaagcctgagaacgaccagctcatcgatatttccggcgataagatg
gtgattgttcacgacggtccgagctttgcggaaccgcatgatgcaacgatcgttcaccgc
tccaagatcaaccctgtcagcttctggagccgtgaggatccattttttgccgatgccgtg
gcgcgggcaaaggcggacggtcttgatctgatggaagccaatgaagtggtgcgtgacggc
aacaaggtgcgtgtctatatgacgtcttccgcgcctgccttcggcctcaccgaattcact
gtccagcaggatgatgaagtgacggtttatgtcaccaatatcgatgagatcgaagacctg
acccatggtttcgctatcgtcaattacggtgtgaacatggaagtcgcaccgcaggcgacg
gcttcggtcacgttcaaggcctccaagccgggtgtgtggtggtattactgctcgtggttc
tgccacgccatgcatatggaaatgcagggccgtatgctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system