KEGG   Brucella canis HSK A52141: BCA52141_II0970Help
Entry
BCA52141_II0970   CDS       T01705                                 

Definition
Cytochrome c heme-binding site
Orthology
K08738  
cytochrome c
Organism
bsk  Brucella canis HSK A52141
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BCA52141_II0970
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCA52141_II0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(635302..635748)
Genome map
AA seq 148 aa AA seqDB search
MSDYGLGRPNKTKEFSNMRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIG
EGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMV
YAGLKDEGKIDDLIAFLKQYDLGGKIKE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattatgggctgggccgccccaataaaaccaaggagttcagcaatatgcgtgct
gcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtcgcgcaaggg
gcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccatcagattggt
gagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgtcactcgggt
tccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtctgggatgag
gaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagaccaagatggtc
tatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctcaagcagtat
gatctgggcggcaagatcaaagaataa

DBGET integrated database retrieval system