KEGG   Brucella canis HSK A52141: BCA52141_II1449Help
Entry
BCA52141_II1449   CDS       T01705                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00010  Glycolysis / Gluconeogenesis
bsk00020  Citrate cycle (TCA cycle)
bsk00620  Pyruvate metabolism
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01200  Carbon metabolism
Module
bsk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA52141_II1449
   00020 Citrate cycle (TCA cycle)
    BCA52141_II1449
   00620 Pyruvate metabolism
    BCA52141_II1449
Enzymes [BR:bsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCA52141_II1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Biotin_lipoyl Abhydrolase_1 E3_binding Biotin_lipoyl_2 Hydrolase_4 RnfC_N HlyD_3 Thioesterase Ser_hydrolase Ndr NQRA HlyD_D23 UPF0227 DUF1100 PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: AEW16079
Position
2:complement(936292..937578)
Genome map
AA seq 428 aa AA seqDB search
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVGFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaattctatatccaaaagtcagtctggaaaccaattccggaacgatttcg
cgttggcacgtccaggatggtgacgcggtcgaacagggccagatcctgttcgagatagac
aatgacaagacagtcgtggaggttgatgcgccgcatgccggaacggtaaagatactgaaa
tcttccaccaccgatgaaatcgaggtcggccagagcgtcgccagcctgtttgccaaggga
gaaacgatcaccgcgcctcccgcaccggccgcagcgcaaaatgcatcggcgccaaaaacg
gcggatatattggcggtcgtcaataaaggtcaaaatggcagggccattgcgacacctctt
gccaggcgcctggccaatgatgccgggatcgaccttgaccggatcggcggcaccggccca
ggcgggcgcatccagaagaaggatgtcattgcagcattgcaaagctgcccatccattccc
gaaaccattgctgcttcgaggcaggcgcggccggaaggcgattgcctgcttaatgccgtg
tggctgcgcaagggcgaagggacgccgcttgtgctgttgcacggctttgcctcggaccac
aacaactggcgggggctttttgccggcacacaatggcaacagcccttgctggcgattgat
ctgccctcccatggcgcttccccgctcgtcgccgtcacgagccttgatgcgattgccgcg
atgatcgaggccacactcaaggccctcgatatccagcgtgcgatccttgtgggccattcc
tttggcgcagccgtcagtgctcgccttgccaatcgcggcaatatcgacatccgcgccttg
ggcctgttttcgccagccgggctcggtccggaaatcaatgtcgggttcgtccagaacttc
gttcgggcaagggcgagggaaagtgtgaccccgtggctgcacgagcttgtgcacgacaag
gccagcatttccgatactttcatcaaggccgtcgtgcagcagcgccaggataacgatctg
agcgacgccatgatggcattttccgaacatttcttcgccgacggcacgcagaccgtctcc
attctcgacgatctcgcctcgctcgaaattcccgtccgcgtcatttacggcaggcaggac
agaatattgccgttccgctacacccggaacctgcccgacaatgtcgcgctgtatgcgttc
gatgcttgcgggcacatgccgcatctggaaaagcgcggcctgagcctgcgcatcctggcg
gaggtttccgcctccgcggcaggctga

DBGET integrated database retrieval system