KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0114Help
Entry
A7A1_0114         CDS       T02384                                 

Definition
Glutamyl-tRNA synthetase GluRS (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7A1_0114
Enzymes [BR:bsl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     A7A1_0114
Amino acid related enzymes [BR:bsl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A7A1_0114
Transfer RNA biogenesis [BR:bsl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A7A1_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3931396..3932847)
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccgagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgcccgcaatcaaggcggtaagtttatc
attcgagttgaggatacagataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggaggagagtac
ggtccataccgtcagtcagagcgtaacgatatctataaagtgtactatgaagagcttctt
gaaaaagggcttgcttataaatgttactgtacggaagaagagcttgaaaaagagcgtgaa
gaacagattgcccgcggagaaatgcctcgttattccggaaaacacagagacctgactcag
gaagaacaggagaaatttatcgccgaaggcagaaaaccaagtattcgtttccgtgtgccg
gaaggaaaagtcatcgccttcaacgacatcgtaaaaggcgaaatttcttttgaatcagat
ggcatcggcgacttcgttattgtgaaaaaggacggaacgcctacttataacttcgcggta
gctattgatgactacttaatgaaaatgacacacgtgctgcgcggtgaggatcatatttct
aacacaccgaaacagattatgatctatcaagcattcgggtgggatattcctcagttcgga
cacatgacgctgattgtaaacgaaagccgtaaaaagctcagcaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttggctacctgccagaagcgctgttcaacttt
atcggactgctaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggttgttgaactg
acgcttccgcatttgcaaaaagcgggcaaagttggcactgagctttctgctgaagaacaa
gagtgggttcgtaaactgatttccctgtatcatgagcaattaagctacggtgcggaaatt
gttgagctgactgatttgttctttacggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaagaacaggttcctgaagtgctcagcacattcgcagcgaagcttgaagag
cttgaggagttcactccggataatatcaaagcatcaatcaaagcagtgcagaaagaaact
ggccataaagggaaaaaactgtttatgccgattcgtgttgctgtaacagggcaaactcac
ggtccggaactgccgcaatcaattgaattgatcggtaaagagactgcaattcagcgttta
aagaatatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system