KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0137Help
Entry
A7A1_0137         CDS       T02384                                 

Definition
(RefSeq) arginase (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A7A1_0137
  Amino acid metabolism
   00220 Arginine biosynthesis
    A7A1_0137
   00330 Arginine and proline metabolism
    A7A1_0137
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A7A1_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
73643..74533
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtagatatgggcccgagtgccatccggtacgctcatctgatcgagcggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaaccgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagctaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttaaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctcggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgaccgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatctggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacaggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system