KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0168Help
Entry
A7A1_0168         CDS       T02384                                 

Definition
Agmatinase (Agmatine ureohydrolase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358090..358962
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASRPEWEEADAILYGMPMDWTVSYRPGSRFGPSRIREVSIGLEEFSP
YLDRDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIK
AMYKKYPDLAIIHFDAHTDLRVDYEGEPLSHSTPIRKAAELIGPHNVYSFGIRSGMKEEF
EWAKENGMHISKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASVHEIARSEVNVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgatgaagcttattcaggaaaagtatttatcgcgagccgtcccgagtgggaa
gaggcggacgccattctttacggcatgccgatggactggacagtcagctatcgcccgggc
tcacgctttggtccaagcagaatccgtgaggtgtcaatcggccttgaggaattcagccca
tatttagaccgcgatctggctgacttgaacttctttgacgccggcgacattccgctgccg
ttcggaaatccgcagcgaagcttggatatgattgaagagtacgtggacagcattttagaa
aaagggaagttcccaatgggtatggggggagagcacctcgtgtcatggcctgtcattaaa
gcgatgtacaagaaatacccagaccttgcgattatccattttgacgcacatacagatctt
cgagttgattatgagggagaaccgctttctcactccacgccgatccgtaaggcggcagaa
ttgatcggaccgcacaatgtgtattcattcggaatccgttccggcatgaaagaagagttt
gaatgggcgaaggaaaacggcatgcacatctcaaaatttgaagtgcttgaaccgctgaaa
gaggtgcttccgaagctggcgggccgtccggtttatgtcacaattgacattgacgtatta
gaccctgcacacgcaccgggtacaggaacggttgacgccggcggcatcacgtctaaagaa
ctgcttgcatccgtccatgaaattgcgcgttcagaggtaaacgtaaagggcgctgactta
gtggaagtcgcgccggtatacgaccactcagagcaaacggcaaacacagccagcaaaatc
atccgtgaaatgctgcttgggtttgtgaaataa

DBGET integrated database retrieval system