KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0357Help
Entry
A7A1_0357         CDS       T02384                                 

Definition
Cytochrome P450:Oxidoreductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bsl00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bsl00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsl00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449927..1453091
Genome map
AA seq 1054 aa AA seqDB search
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNFV
AEVCDESRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAHRILLPSFSQKAMKGYHSM
MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML
RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDENIKDLLSLM
LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADCV
LTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI
PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP
KHGTPLLVLYGSNLGTAEGIAGELVAQGCQMGFTAETAPLDDYIGKLPEEGAVVIVTASY
NGAPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR
LTAIGEGDAADDFESHRESWENRFWKETMDAFDINELAQKEDRPSLSITFLSEATETPVA
KAYGAFEGIVLENRELQTAASTRSTRHIELEIPAGKTYKEGDHIGILPKNSRELVQRVLS
RFGLQSNHVIKVSGSAHMAHLPMDRPIKVVDLLSSYVELQEPASRLQLRELASYTVCPPH
QKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSSP
KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPDEPE
TPMIMIGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQD
GLVTIRRCYSRVENEPKGYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVEKTLRL
AYEAEKGASQEESAEWLQKLQDQRRYVKDVWTGM
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcaagcgcaatacctcagcccaaaacatacggacctttaaaaaatcttccg
catctggaaaaagaacagctttctcaatccttatggcggatagctgatgaattgggaccg
attttccgttttgattttccgggagtatccagtgtttttgtctcgggccacaattttgtg
gctgaagtatgtgatgaaagccgctttgacaagaaccttggcaaaggcttgcaaaaggtg
cgtgagttcggaggagatggcttatttacaagctggacgcacgaaccgaactggcaaaaa
gcccaccgcattttgctgccgagttttagtcaaaaagcgatgaaaggctatcattctatg
atgctggatatcgcaacccagctgattcaaaaatggagccggttaaaccctaatgaagaa
attgatgtagcggacgatatgacacgtctgacgcttgatacgattgggttatgcgggttt
aactatcgattcaacagcttttaccgtgattcacagcatccgtttatcaccagtatgctc
cgtgccttaaaagaggcgatgaatcaatcgaaaagactgggcctgcaagataaaatgatg
gtgaaaacgaagctgcagttccaaaaggatatagaagtcatgaactccctggtcgataga
atgatagcggagcgaaaggcgaatccggatgaaaacatcaaggatctcttgtctctcatg
ctttatgccaaagatccagtaaccggtgaaacgctggatgatgaaaacataaggtatcaa
atcatcacatttttaattgctggacatgagacaacaagcgggttgctttcctttgcgatt
tattgtctgcttacacatccggaaaaactgaaaaaagctcaggaggaagcggattgcgtg
ttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacattcggatggtt
ttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaaggag
gatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgttttaatt
ccaaaactgcaccgggatcaaaacgcttggggaccggatgcggaagatttccgtccggaa
cggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaatgggcag
cgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtcttgta
ttaaagcattttgaattgataaaccatactggctacgaactaaaaatcaaagaagcatta
acgatcaagccggatgattttaaaattactgtgaaaccgcggaaaacagcggcaatcaat
gtacagagaaaagaacaggcagacatcaaagcagaaacaaagccaaaagaaaccaaacct
aaacacggcacacctttactcgttctttacggttcaaaccttgggacagctgagggaata
gccggtgaactggttgctcaaggctgccagatgggctttacagctgaaacggctccgctt
gatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttcttat
aatggggcgccgcctgataatgctgccggctttgtagagtggctgaaagagcttgaggaa
ggccaattgaaaggtgtttcctatgcggtattcggctgcgggaaccggagctgggccagc
acgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcgcgt
ttaacagcgattggggaaggtgacgccgccgatgattttgaaagccatcgcgagtcttgg
gaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaattagcccagaaa
gaagacaggccttcattatcgattacttttctcagtgaagcgacggaaacgccggttgct
aaagcatatggcgcgtttgaagggattgtgttagagaatcgagaactccagacagctgcc
agcacgcgttcaacccgccatattgaattggaaattccggctggtaaaacatataaagaa
ggcgatcatatcggaatcctgccgaagaacagcagggagcttgttcagcgggttctcagc
cgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggctcat
ctgccgatggatcggccaatcaaagtagtggatttattgtcgtcctatgtagagctgcag
gaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccgcat
caaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtacttgca
aaacgtcttaccatgcttgattttttagaggattatcctgcctgcgaaatgccgtttgaa
cggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctcaccg
aaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatggagc
ggccgaggtgaataccggggtgttgcctctaattacttagcagaattgaatacaggtgat
gcagcagcctgcttcattcgtacaccgcagtccggattccagatgccggatgagcctgaa
acgcctatgattatgatcgggccgggcacaggaattgcaccattcaggggctttattcag
gcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttcggc
tgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacaggac
ggtttggtcacaatccgccgatgctactcgcgcgtcgaaaacgaaccaaaaggatatgtc
cagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggctcat
atttacgtatgcggtgatggatcgcaaatggctcctgatgtagagaaaactttgcgattg
gcgtatgaagctgaaaaaggagcaagtcaggaagaatcagctgaatggctgcaaaagcta
caagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system