KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0390Help
Entry
A7A1_0390         CDS       T02384                                 

Definition
exodeoxyribonuclease V subunit alpha YrrC
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A7A1_0390
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A7A1_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418298..1420694
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNGTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYENQFPESEFLLALGELEERMDVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtc
aacacagtcatctatcataatggcaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaaattcgggctc
caatttcaggcggagcatttcaaaaaggagattccaacgactaaggaaggcatcattcaa
tatttatcgagtgatttattcgaggggatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaataaaatattggctgacgcttcagtgctttatgatgtt
cccagactctcaaaaaagaaagcagacacgctggctggcgcattgcagcggcatcaggga
ctggagcaaatcatgatttccttgaatcagtttggctttggcccgcagctgtctatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaggaaaatccttatcagctt
gtgaaggatgtagaaggcatcgggtttggaaaagcggatgagctgggcagcagaatgggt
ctttcgggtaatcatcctgagcgggtaaaagctgctattttgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggaacagctgatcattgacacccaatct
ctgttaaatcagtcagcaagggaaggacagcgcatcacagaaatggatgccgctaacgcg
attattgcccttggagaaaataaagacattgtcatagaagatggccgctgttattttcct
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgctagccaaacc
gaatatgagaaccagtttcccgaatcagagtttttgctcgcgttgggagaactggaagaa
cggatggacgttcagtatgcccccagccagaaggaagcgattcaaaaagccctttcctcg
ccgatgcttcttttaacaggcggcccgggaacaggaaaaacgacggtaatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacggatgagtgaa
tcaacgggactccctgcagttacgatacacaggctgcttggctggaacggcgctgaaggc
tttactcatacagaggatcagccgatcgaagggaagctgttaattatcgatgaagccagt
atgcttgatatatggctggcgaatcatttgttcaaggcgatccctgatcatatacaaatc
atcattgtcggagacgaagaccagctgccttccgtcggtccgggacaagtgctcagagac
ctgctggcatcccaggtgattccgactgtgagactgacagacatctatcgccaggcagaa
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgccccgacaaaggaccgttcctttattcgctgcggcgggtcgcaaatcaaagaagta
gttgagaaggttgtcgccaatgcattgaaaaaaggctatacagcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagccggcattaatgaattgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtgttcaacggagat
attggcgaaatcacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gtcgtttcttttgacggcaatgaaatgacatttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctattatagaatgctcagaagaaaccttctttataccgcgattaca
agagcgaagaaatttctcattttatgcggggaagaggaggcgctggagtggggcgtgaaa
aataatgatgcaactgtcagacagacctccttgaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaagctttgcaaaaagagctcccgttcagcgtacacgacgcc
aacattggcatggaaggcattacaccattcgattttatgaaagaagaacagcaataa

DBGET integrated database retrieval system