KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0416Help
Entry
A7A1_0416         CDS       T02384                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1390211..1390816
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERSQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEEIGLTTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgttaaagggacgattgattatgtatctccccaatatattgtcatagag
aacggcggcatcggctatcagattttcacgccgaatccgtttatatataaggagagaagc
caagaaacgatttttacataccatcatatcagagaggatgctttttcgctttatggtttt
tcaacaagagaggagaaggcgctctttacaaagctgttaaacgtgaccggaattggcccg
aaaggagcacttgccatcttgggctcgggtgatcccggagcggtcatccaagcaattgaa
aatgaagatgaagcttttttggtcaagtttcctggagtaggaaagaaaaccgcacgccag
attattctagatttaaaaggaaagctggcagatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaagcaaacagcggaaacggctcttgaagaagcactt
gaagccctcagggttctcggatatgctgaaaaagaaatcaaaaaggtgcttcctcacctt
aaagaagaaattgggctgacaacagaccaatatgtgaaaaaagcattacaaaaactatta
aagtaa

DBGET integrated database retrieval system