KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0567Help
Entry
A7A1_0567         CDS       T02384                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A7A1_0567
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7A1_0567
   00020 Citrate cycle (TCA cycle)
    A7A1_0567
   00620 Pyruvate metabolism
    A7A1_0567
Enzymes [BR:bsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A7A1_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2538041..2539369)
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESDDAKTEAQVQSTAEAGQDVAKEEQAQEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgacgaggtagacgaagatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgatgcacctggt
tacgaagatcttcaatttaaaggcagcgacgagtctgacgatgcgaaaactgaagcacaa
gttcagtcaactgcagaagctggacaagacgttgcgaaagaagagcaagctcaagagcct
gcaaaagctactggcgcagggcagcaggatcaagctgaagttgacccgaacaaacgcgtg
atcgctatgccttccgtacgtaaatatgctcgtgaaaaaggcgtagacatccgtaaggtt
actggttcaggcaacaacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcgcaagaagctgcaccgcaagaaacagctgcaccacaagaaacagctgctaaaccg
gctgctgcaccagctccagagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcaaaagcgatggttaactctaaacacactgctcctcacgtaacgtta
atggacgaagtggacgtaacaaaccttgttgcacatcgtaaacagttcaaacaagttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagatgaagtcatccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgagatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgtatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system