KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0609Help
Entry
A7A1_0609         CDS       T02384                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of acetoi cleaving system (Acetoin dehydrogenase E2 component)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00010  Glycolysis / Gluconeogenesis
bsl00020  Citrate cycle (TCA cycle)
bsl00620  Pyruvate metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
bsl01130  Biosynthesis of antibiotics
bsl01200  Carbon metabolism
Module
bsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7A1_0609
   00020 Citrate cycle (TCA cycle)
    A7A1_0609
   00620 Pyruvate metabolism
    A7A1_0609
Enzymes [BR:bsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A7A1_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 HlyD_D23 Biotin_lipoyl_2 PYNP_C RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AGA21227
Position
complement(3185916..3187112)
Genome map
AA seq 398 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMEIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEASAPVAEDNMPQAVQPVKQENKPAASKKDRMKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKDQAKPVSEQKAQEIPVTGMR
KVIATRMQESLANSAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFISRAAVLA
LQAHPVLNSFYQNERIITHPHVHLGMAVALENGLVVPVIRHAEKLSLIELAQSISENAKK
AREGRAGSEELQGSTFSITNLGAFGVEHFTPILNPPETGILGIGASYDTPVYQGEEIVRS
TILPLSLTFDHRACDGAPAAAFLKAMKTYLEEPAALIL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaaaagtagtgatgccaaaattgggaatggccatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggagatcgaagcgcctgaaaaaggaacgctgatcgatatcaaa
gtgaaagagggagaagaggttccgcccggcacagcgatctgctatatcggggacgccaat
gagtcggtgcaggaagaggcgagcgcgcctgttgctgaagacaatatgccgcaagccgtt
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagatcgaatgaaaatatct
ccagtcgccaggaaaatagcagaaaaagcaggattagacctaaaacaactgaaaggaact
ggaccaggcggacgaatcgtgaaggatgacgtaacaaaggctcttgctgaacagaaaaaa
gatcaggcaaagcctgtgtcggagcagaaagcgcaggaaatcccggtgacaggcatgaga
aaggtcatcgctacccgaatgcaggaaagcctggcaaacagcgcgcagctgacgatcacg
atgaaagctgatatcaccaagcttgccactcttcaaaaacagctttcaccaactgcggaa
gagagatacggcacaaaactgacgatcactcattttatctcaagagccgccgttctcgct
ctgcaagctcaccctgtgctgaacagcttttatcaaaatgagcgcatcatcacacatccc
catgtgcaccttggtatggctgtagccttggaaaatggcttagtggtgcctgtcatccgc
catgctgaaaagctatcgctgatagaactggctcaatctatctcagaaaatgccaaaaaa
gcacgcgagggacgtgcgggaagcgaagaactgcaaggatctactttctccattacaaac
cttggcgcgtttggagttgagcatttcacaccgatactaaatccgccggaaacaggcatt
ctcggcatcggagcaagctatgacacgccggtgtatcaaggggaggagatcgtcagaagc
acgatcctgccactcagcctgacatttgatcacagagcgtgtgacggcgcccctgccgct
gcattcctgaaggcgatgaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system