KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0701Help
Entry
A7A1_0701         CDS       T02384                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A7A1_0701
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     A7A1_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2127476..2128975)
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMIASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDNKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRA
GDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgatagcttcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagagatgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatatcttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccatatgcggaagaagtgatttcagttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacagagtggggaaca
agcgacgcgtctggcaatggcggtgtattccttgatcaatcgagggaatggctgaaatat
ctcgacaacaagaccatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattcgacgaaggacattcct
gaaacgccatcaaaagataaacccacacaggaaaatggtatttctgtacagtacagagca
ggggatgggagtatgaacagcaaccaaatccgtccgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcactgcccgttactggtataaagcgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagattggatgcggcaatgtgacacacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggatttaaaaac
ggaacgttggcaccgggagcaagcacagggaatattcagctccgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacagaaccaaattag

DBGET integrated database retrieval system