KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0773Help
Entry
A7A1_0773         CDS       T02384                                 

Definition
Formidopyrimidine DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253684..1254526
Genome map
AA seq 280 aa AA seqDB search
MDVPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRR
GKFLLFHLDHYVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMH
LFKPGEEAGELPLSQLGPEPDAEEFTSAYLKERLAKTNRAVKTALLDQKTVVGLGNIYVD
EALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQ
HFVYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQKKKVA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgccggaattaccagaggttgagacggtccggcgcactctgaccgggcttgta
aagggaaaaacaatcaaatcggtagagatcagatggccgaatatcatcaaacggcctgcc
gaaccggaggaatttgcgcgaaaactagcaggagaaacgatacagtccatcggaagacgg
ggaaagtttttactgtttcatttagatcattatgttatggtttctcaccttcgaatggaa
ggaaaatacggtcttcatcaagccgaggagcctgacgataaacacgtgcatgtcatattc
acgatgacggatggaacccagctccggtacagggatgtgcggaaatttggaaccatgcac
ttatttaaaccgggagaagaagcgggcgagctcccgctttctcagttagggccggagccg
gatgcagaagaatttacaagtgcgtatttaaaagaacggcttgcgaaaacaaaccgcgct
gtcaaaactgccctactggatcaaaaaacggtagttggactagggaacatttatgtggat
gaggctcttttcagagcaggtgtccatcccgagacaaaagcaaatcaattatcagataaa
acaatcaaaacccttcacgctgaaatcaaaaacactctgcaggaggcgattgatgcgggc
ggaagcacagtccgttcatatatcaactcccaaggggaaatcggaatgttccagctgcag
cattttgtgtacggaaaaaaagacgagccatgcaaaaattgcggaacgatgatttcgaaa
attgtcgttggaggaagaggcacgcatttttgcgcaaagtgccagaaaaaaaaagtagca
taa

DBGET integrated database retrieval system