KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1035Help
Entry
A7A1_1035         CDS       T02384                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A7A1_1035
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7A1_1035
Enzymes [BR:bsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     A7A1_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427586..428896
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALQTEAPFEYVRKMRASVLVMGPLLARTGHARVALPGGCAIG
SRPIDQHLKGFEAMGAEIKVGNGFIEAEVKGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINGMGGKIRGAGTGTIKIEGVEKLHGVKHHIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVTIKDEGEGLRVIGPKELKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVDFHQKLAALGADIERVNDE
SASEQENKEVVSDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtcaaagttgaaggc
gctaaaaatgccgttttacctgttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatttgtgatgtacctacgctctccgatgtatatacaattaacgaagtgttgcgtcat
ttaggagcagatgtgcattttgaaaataatgaagtgactgtaaatgcttcatacgctttg
caaactgaagcaccttttgaatatgttcgtaaaatgcgtgcgtctgtgcttgtcatgggg
ccgcttcttgcgcgtacaggtcatgcaagagttgcacttccgggcggatgcgcaattggt
tccagaccgattgatcagcatttaaaaggttttgaagcaatgggcgcagaaatcaaagtc
ggtaatggcttcattgaagcggaagtaaaaggccgactgcaaggcgcaaaaatttatctg
gacttcccaagtgtaggagctacagagaacctgattatggcagccgctctagctgaagga
acaacaacgctggaaaacgtggcaaaagaacccgaaatcgttgatttagcaaactatatc
aacggcatgggcggaaaaatccgcggagctggcaccggcaccatcaaaattgaaggagtc
gaaaagcttcacggcgtaaaacaccatattattcctgaccgtattgaagcgggcacattt
atggttgctgctgcaatcactgaaggaaacgtattagtaaaaggagcggttcctgaacac
ctcacctctttaattgcaaaaatggaagagatgggtgtaacaattaaggatgaaggtgaa
ggtctgcgtgtcatcggcccgaaagaacttaaaccgattgacatcaaaacaatgcctcac
ccgggcttcccgactgatatgcagtcacaaatgatggcgcttctgcttcgtgcaagcggc
acaagcatgattacagaaaccgtttttgaaaaccgttttatgcatgcggaagaattccgc
cgtatgaatggtgatatcaagattgaaggacgttctgtcatcattaacggtcctgtacag
cttcagggagctgaagttgcagcgactgatttgcgtgcaggtgcagcgctgattcttgcg
gggttagtggctgaaggtcacacacgtgttactgaattgaagcacttagaccgcggttac
gttgatttccatcagaagcttgccgctctgggcgcagacatcgaacgtgtaaatgatgag
tctgcttctgagcaagagaataaagaagtcgtttctgacttaaatgcataa

DBGET integrated database retrieval system