KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1154Help
Entry
A7A1_1154         CDS       T02384                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00040  Pentose and glucuronate interconversions
bsl00052  Galactose metabolism
bsl00500  Starch and sucrose metabolism
bsl00520  Amino sugar and nucleotide sugar metabolism
bsl01100  Metabolic pathways
bsl01130  Biosynthesis of antibiotics
Module
bsl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A7A1_1154
   00052 Galactose metabolism
    A7A1_1154
   00500 Starch and sucrose metabolism
    A7A1_1154
   00520 Amino sugar and nucleotide sugar metabolism
    A7A1_1154
Enzymes [BR:bsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A7A1_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AGA21772
Position
complement(551174..552058)
Genome map
AA seq 294 aa AA seqDB search
MKLKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTG
KSKRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCAR
NFIGDEPFAVLLGDDIVQADTPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTS
EGRRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLN
EIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattgaaaaaagtacgtaaagccataatccctgccgcaggtctcggaacgagattc
ttgccggctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccatt
caatacataattgaagaagctgttgaagccggtattgaagatattattatcgtaacagga
aaaagcaagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaaccta
gaagaaaaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgac
attcactatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcgcgc
aactttatcggcgatgagccgtttgcggtactgcttggagacgatattgttcaggctgat
acaccagggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggt
gttcagcaggtgcctgaagaagaaacacaccgctacggcattattgacccgctgacaagt
gaaggccgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcacct
tctaatcttgccatcttaggccgttacgtattcacgcctgagattttcatgtatttagag
gagcagcaggttggcgccggcggagaaattcagctcacagatgccattcaaaaactgaat
gaaattcaaagagtgtttgcttacgactttgaaggcaagcgttatgatgttggtgaaaag
ctcggctttatcacaacaactctagaatttgcgatgcaggataaagagcttcgcgatcag
ctcgttccatttatggaaggtttactaaacaaagaagaaatctaa

DBGET integrated database retrieval system