KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1236Help
Entry
A7A1_1236         CDS       T02384                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4014355..4014951)
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtagta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacgcgcagggataagtct
gttatctgtgttgtgcaagaccctaaggatgttatcgctatggagaaaatgaaggaatac
aatggacagtatcacgttcttcacggcgctatttctccaatggacggcatcggaccggag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatc
ctcgcgacaaaccctaatatagaaggggaagcaacggcgatgtatatatcaaggctcctc
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system